Recombinant Human Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Description

Functional Roles

ST7 interacts with proteins involved in signal transduction and endocytosis:

Key Interactions

Protein PartnerFunctional Role
RACK1Mediates protein kinase C signaling .
MIBPRegulates integrin-mediated adhesion .
SARAFacilitates SMAD-dependent TGF-β signaling .

Mechanistic Insights:

  • Modulates extracellular matrix remodeling by downregulating SPARC, IGFBP5, and matrix metalloproteinases .

  • May influence in vivo tumorigenicity, though its role is context-dependent .

Cancer-Related Controversies

While initially proposed as a tumor suppressor, ST7’s role in cancer is inconsistent:

Research Findings

Study TypeFindingsSource
Mutational AnalysisRare coding mutations in epithelial cancers (1 missense change in 38 cell lines) .
Expression in TumorsUpregulated in some cancers (e.g., prostate), downregulated in others .
In Vivo SuppressionST7 overexpression reduced tumorigenicity in prostate cancer models .

Product Data

ParameterDetails
Purity>95% (SDS-PAGE, silver stain) .
Reconstitution200 µg/mL in PBS .
Endotoxin Levels<1.0 EU/µg .
Storage-70°C (avoid freeze-thaw cycles) .

Applications:

  • Ligand-binding studies (e.g., with LRPAP1) .

  • Cell culture and ELISA (carrier-free version for assays where BSA interferes) .

Technical Notes

  • N-Terminal Variants: Two sequences (Asn28 and Glu33) arise from splice variants or signal peptide cleavage .

  • Gene Associations: Maps to 7q31.1, an autism-susceptibility locus, though coding mutations are not linked to autism .

Research Implications

ST7/LRP12’s dual roles in signal transduction and matrix remodeling make it a candidate for studying:

  • Tumor microenvironment interactions.

  • Cross-talk between LDLR family proteins and growth factor pathways.

  • Epigenetic regulation in cancers with 7q31.1 deletions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ST7; FAM4A1; HELG; RAY1; Suppressor of tumorigenicity 7 protein; Protein FAM4A1; Protein HELG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ST7
Target Protein Sequence
MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN
Uniprot No.

Target Background

Function
ST7 may function as a tumor suppressor.
Gene References Into Functions

Functional Role of ST7 as a Tumor Suppressor:

  1. ST7, a key tumor suppressor gene, is silenced by PRMT5. (PMID: 24453002)
  2. ST7 suppresses tumorigenesis by regulating genes involved in cellular structure maintenance and oncogenic pathways. (PMID: 20238225)
  3. Except for one missense mutation in a breast cancer cell line, mutational analysis across various cell lines and primary epithelial cancers revealed no ST7 mutations. (PMID: 12107844)
  4. The RAY1/ST7 tumor suppressor locus on chromosome 7q31 is a complex, multi-transcript system. (PMID: 12213198)
  5. In most human cancers with loss of heterozygosity at 7q31.1-q31.2, ST7 inactivation is not a primary event. (PMID: 12231539)
  6. While loss of heterozygosity at 7q31-q35 is implicated in some esophageal carcinomas, ST7 is not the primary target gene affected by this somatic event. (PMID: 12545169)
  7. ST7 somatic mutations are not frequently involved in the pathogenesis of human malignant myeloid tumors. (PMID: 14534688)
  8. ST7 may not be the primary target gene inactivated at the 7q31 site in gastric carcinoma. (PMID: 14669308)
Database Links

HGNC: 11351

OMIM: 600833

KEGG: hsa:7982

STRING: 9606.ENSP00000265437

UniGene: Hs.368131

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed, with highest levels in heart, liver and pancreas.

Q&A

What is the molecular structure of human ST7/LRP12 protein?

Human ST7 (Suppressor of Tumorigenicity 7), also known as LRP12, is a type I transmembrane protein belonging to the LDLR (Low-Density Lipoprotein Receptor) superfamily. The human ST7 cDNA encodes 859 amino acids with the following structure :

  • 32 amino acid signal sequence

  • 460 amino acid extracellular domain (ECD) containing:

    • Two CUB domains

    • Five LDLR class A domains

  • 21 amino acid transmembrane domain

  • 346 amino acid cytoplasmic domain with motifs implicated in endocytosis and signal transduction

The protein exhibits high evolutionary conservation, with human ST7 sharing 95% amino acid sequence homology with mouse and rat, 96% with canine, and 98% with bovine, equine, and porcine ST7 within the extracellular domain .

What expression systems are optimal for producing recombinant human ST7/LRP12?

Based on commercially available recombinant ST7 proteins, HEK 293 cells are the predominant expression system for producing functional human ST7/LRP12 protein fragments . This mammalian expression system provides appropriate post-translational modifications.

For recombinant protein production:

  • The most common expression construct includes amino acids Asn28-Ile488, representing the extracellular domain

  • Proteins are typically tagged with a C-terminal 6-His tag for purification purposes

  • Expression quality can be verified through SDS-PAGE and HPLC

  • Purification typically achieves >95% purity with endotoxin levels <1 EU/μg

When using recombinant ST7/LRP12 for functional assays, researchers should note that carrier-free versions (without BSA) are preferable for applications where the presence of BSA could interfere with experimental outcomes .

How does ST7/LRP12 expression vary across normal tissues and cancer samples?

ST7 is widely expressed in normal tissues with a defined distribution pattern :

  • Highest expression: Heart and skeletal muscle

  • Notable expression: Fibroblasts

  • Variable expression: Other tissue types

In cancers, ST7 expression shows inconsistent patterns, contradicting its initial characterization as a classic tumor suppressor :

  • Not consistently downregulated across cancer types

  • No consistent pattern of mutation or loss of heterozygosity

  • Upregulation observed in certain cancer types

  • May influence expression of extracellular matrix molecules involved in remodeling (SPARC, IGFBP-5, matrix metalloproteinases)

This variable expression pattern requires careful experimental design when studying ST7 in specific cancer contexts. RT-PCR remains the primary method for expression analysis, with quantitative PCR providing more precise measurements across tissue samples .

What methodologies should be used to investigate the alternative splicing variants of ST7/LRP12?

Genomic sequencing indicates the possibility of up to 18 splicing isoforms of ST7, though their expression patterns remain understudied . To investigate these variants:

  • RNA-Seq approach:

    • Use deep sequencing to identify all potential splice variants

    • Employ junction-spanning primers to specifically amplify individual variants

    • Apply computational tools like DESeq2 with thresholds of |log2-fold change| > 1.5 and adjusted p-value < 0.05 for differential expression analysis

  • RT-PCR methodology:

    • Design primer pairs spanning potential splice junctions

    • Perform tissue-specific expression analysis

    • Validate with quantitative PCR for accurate measurement

  • Analysis of functional differences:

    • Express individual isoforms in appropriate cell models

    • Compare subcellular localization using immunofluorescence

    • Assess functional differences through activity assays

The ST7 isoform b is of particular interest as it shows species-specific differences - completely absent in fugu fish (both the terminal 3′ exon and alternatively spliced exon 7) and only partially present in mice (terminal 3′ coding exon is absent) .

How can researchers effectively identify and analyze regulatory elements controlling ST7 expression?

Cross-species sequence comparison has proven valuable for identifying regulatory elements of ST7 . A methodological approach should include:

  • Comparative genomic analysis:

    • Perform multiple species alignments (human-baboon-cow-mouse-fugu)

    • Identify conserved non-coding sequences using tools like PipMaker and VISTA

    • Focus on regions with >70% identity and ≥100bp length in distantly related species

  • Functional validation of candidate regulatory elements:

    • A notable example is the 500bp conserved noncoding region between exons 8 and 9 of ST7

    • This region shows high conservation between human and mouse with minimal gaps

    • It's approximately 10,000 times more likely to be under selection than evolutionary drift

  • Experimental validation approaches:

    • Gain-of-function assays by adding putative regulators to reporter genes with the ST7 promoter

    • Transfection of appropriate cell lines

    • CRISPR-based manipulation of candidate regulatory regions

What approaches should be used to reconcile contradictory data about ST7's role as a tumor suppressor?

ST7 was initially proposed as a tumor suppressor, but subsequent research has revealed a more complex picture with inconsistent expression patterns across cancers . To address this contradiction:

  • Context-specific analysis approach:

    • Perform cancer type-specific expression studies

    • Correlate expression with clinical outcomes using Kaplan-Meier analysis and Cox logistic regression models

    • Use ROC (Receiver Operating Characteristic) analysis to evaluate the discrimination ability of ST7 as a biomarker

  • Functional studies methodology:

    • Compare ST7 knockdown/overexpression effects across multiple cell lines

    • Assess impact on hallmark cancer pathways (proliferation, invasion, apoptosis)

    • Investigate interaction with known oncogenes and tumor suppressors

  • Pathway analysis:

    • Investigate ST7's association with extracellular matrix remodeling (SPARC, IGFBP-5, MMPs)

    • Apply gene set enrichment analysis (GSEA) to identify affected pathways

    • Use single-sample GSEA (ssGSEA) to analyze correlation with immune infiltration

Research should focus on ST7's contribution to modulating in vivo tumorigenicity rather than assuming a classic tumor suppressor role .

What methods are most effective for studying ST7/LRP12 protein interactions and binding partners?

To characterize ST7/LRP12 protein interactions:

  • Binding assays for known ligands:

    • When rhST7 is immobilized at 0.5 µg/mL, rhLRPAP (Catalog # 4296-LR) binding shows 50% of optimal response at approximately 0.6-3 μg/mL concentration

    • ELISA-based binding assays provide quantitative measurements of interaction strength

  • Novel interaction partner discovery:

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening

    • Proximity labeling methods (BioID, APEX)

    • Surface plasmon resonance for kinetic measurements

  • Functional validation:

    • Assess impact of identified interactions on ST7's known functions

    • Map interaction domains through truncation mutants

    • Evaluate effects on downstream signaling pathways

When designing interaction studies, researchers should consider ST7's potential role in the internalization of lipophilic molecules and/or signal transduction pathways .

How should researchers establish state-of-the-art approaches when studying ST7 in cancer biology?

Establishing state-of-the-art (SOTA) approaches for ST7 research requires a systematic methodology :

  • Six-step approach for conducting SOTA reviews:

    • Framework identification and definition

    • Comprehensive literature search (examine articles labeled as SOTA reviews)

    • Critical assessment of paradigmatic foundations

    • Chronological synthesis of knowledge development

    • Identification of current boundaries and limitations

    • Projection of future research directions

  • ST7-specific considerations:

    • Analysis of ST7's role beyond traditional tumor suppressor categorization

    • Integration of genomic, transcriptomic, and proteomic data

    • Consideration of lncRNA ST7-AS1, which has been identified as a potential biomarker in breast cancer

    • Examination of ST7's impact on extracellular matrix remodeling

  • Statistical methodological rigor:

    • Employ Kaplan-Meier survival analysis with hazard ratio (HR) and 95% CI

    • Use univariate and multivariate Cox logistic regression models

    • Apply two-sided p-values with significance threshold of <0.05

    • Utilize DESeq2 R package for expression analysis with thresholds of |log2-fold change| > 1.5 and adjusted p-value < 0.05

What are the optimal reconstitution and storage conditions for recombinant human ST7/LRP12 protein?

For optimal handling of recombinant human ST7/LRP12 protein :

  • Reconstitution:

    • Lyophilized protein should be reconstituted at 200 μg/mL in PBS

    • Ensure complete solubilization before use

  • Storage conditions:

    • Use a manual defrost freezer

    • Avoid repeated freeze-thaw cycles

    • Ship at ambient temperature

    • Upon receipt, store immediately at recommended temperature

  • Quality control considerations:

    • Verify protein quality through SDS-PAGE

    • Confirm activity through functional binding assays

    • For carrier-free versions, be aware that absence of BSA may affect stability

What techniques should be employed to study ST7's evolutionary conservation across species?

Based on research methodologies described in the literature :

  • Multiple sequence alignment approach:

    • Compare protein sequences across species (human, baboon, cow, mouse, fugu)

    • Focus on domain-specific conservation patterns

    • Analyze human-baboon (90% identity), human-cow, human-mouse, and human-fugu comparisons

  • Visual analysis tools:

    • Use PipMaker alignment with PipTools program for gap-free segments (≥100 bp and ≥70% identity)

    • Apply VISTA plots for visualization of pairwise global alignments

    • Analyze with 100 bp sliding window to calculate percent identity at each base pair position

  • Interpretation strategy:

    • Human-baboon sequences align along almost entire lengths with ~90% identity

    • Human-cow and human-mouse comparisons reveal conserved elements outside exonic sequences

    • Human-fugu comparison primarily shows conservation in exonic regions only

    • Pay special attention to isoform b, which shows species-specific differences

How can researchers effectively utilize lncRNA ST7-AS1 as a biomarker in cancer studies?

Research indicates that long noncoding RNA ST7-AS1 may serve as a potential biomarker in breast cancer . To effectively utilize this in research:

  • Expression analysis methodology:

    • Extract RNA sequencing data and clinical data from databases like TCGA

    • Convert HTSeq-FPKM data into TPM (Transcripts Per Million) reads

    • Compare expression between high and low lncRNA expression groups

  • Statistical analysis approach:

    • Apply Chi-squared test, Fisher exact test, Kruskal-Wallis test for correlations with clinicopathological characteristics

    • Use Wilcoxon signed-rank test and Wilcoxon rank sum test for expression comparisons

    • Employ logistic regression for multivariate analysis

  • Survival analysis techniques:

    • Generate Kaplan-Meier survival curves with hazard ratios (HR) and 95% CI

    • Apply univariate and multivariate Cox logistic regression models

    • Focus on 1-, 3-, and 5-year survival rates using nomogram established through Cox proportional hazard regression

How should researchers address data contradictions in ST7 expression patterns across different cancer types?

To resolve contradictory findings regarding ST7 expression in cancer :

  • Standardized analysis framework:

    • Use consistent methodology across studies (RNA-seq, RT-PCR, protein detection)

    • Apply uniform thresholds for determining up/downregulation

    • Account for tissue-specific baseline expression levels

  • Contextual interpretation:

    • Consider tumor microenvironment influences

    • Analyze correlation with specific cancer subtypes and stages

    • Examine co-expression patterns with other genes

  • Integration of multi-omics data:

    • Combine transcriptomic, proteomic, and genomic analyses

    • Assess epigenetic regulation (methylation, histone modifications)

    • Evaluate impact of genomic alterations (mutations, copy number variations)

What strategies should be used to investigate the relationship between ST7 and extracellular matrix remodeling?

ST7 expression may be associated with downregulated expression of extracellular matrix molecules involved in remodeling . To investigate this relationship:

  • Co-expression analysis:

    • Perform correlation studies between ST7 and ECM molecules (SPARC, IGFBP-5, MMPs)

    • Use public databases and tissue microarrays for large-scale analysis

    • Apply gene set enrichment analysis to identify affected pathways

  • Mechanistic studies:

    • Use ST7 knockdown/overexpression models to assess impact on ECM gene expression

    • Analyze secreted matrix proteins through proteomic approaches

    • Employ 3D culture models to assess ECM organization and remodeling

  • Functional assays:

    • Measure cell invasion and migration in different ECM contexts

    • Assess matrix degradation capacity

    • Evaluate cell-matrix adhesion properties

When designing these studies, researchers should focus on ST7's potential role in modulating in vivo tumorigenicity through ECM interactions, rather than assuming a classic tumor suppressor function .

What emerging technologies might advance our understanding of ST7's biological functions?

Several cutting-edge approaches could enhance ST7 research:

  • Single-cell technologies:

    • Apply single-cell RNA-seq to assess cell-specific expression patterns

    • Use single-cell proteomics to analyze protein levels and modifications

    • Implement spatial transcriptomics to map ST7 expression within tissue architecture

  • Advanced protein interaction studies:

    • Apply hydrogen-deuterium exchange mass spectrometry for structural analysis

    • Use cryo-electron microscopy to determine 3D structure

    • Implement high-throughput interactome analysis

  • CRISPR-based functional genomics:

    • Perform genome-wide CRISPR screens to identify synthetic lethal interactions

    • Use CRISPR activation/inhibition to modulate ST7 expression

    • Apply base editing for precise mutation introduction

How might understanding ST7's evolutionary conservation inform therapeutic approaches?

The high conservation of ST7 across species suggests important biological functions :

  • Comparative functional analysis:

    • Investigate species-specific differences in ST7 isoform expression

    • Examine conservation of regulatory elements

    • Analyze evolutionary pressure on specific domains

  • Therapeutic target identification:

    • Focus on highly conserved regions as potential functional sites

    • Use cross-species data to predict drug target viability

    • Exploit species-specific differences for model system selection

  • Translational approaches:

    • Apply findings from evolutionary studies to human disease contexts

    • Develop models that account for species-specific differences

    • Prioritize conserved interaction partners as potential co-targets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.