Recombinant Human Surfeit locus protein 1 (SURF1)

Shipped with Ice Packs
In Stock

Description

Introduction

The Surfeit locus protein 1 (SURF1) is a protein crucial for the assembly of cytochrome c oxidase (COX), a key enzyme in the mitochondrial respiratory chain . Mutations in the SURF1 gene, located on chromosome 9, can lead to SURF1 deficiency, resulting in severe neurological disorders such as Leigh Syndrome (LS) . SURF1-related LS is characterized by progressive neurodegeneration, particularly affecting the brainstem and basal ganglia .

Genetics and Molecular Biology

The SURF1 gene encodes a protein essential for the proper assembly of COX, also known as complex IV, which is vital for oxidative phosphorylation . The SURF1 gene contains 10 exons and its mutations are a common cause of Leigh Syndrome, an inherited neurometabolic disorder . Over 120 patients with LS associated with pathogenic SURF1 variants have been reported in published literature . The most frequent mutation is c.312_321del110insAT .

3.1. Leigh Syndrome (LS)

SURF1 deficiency is a significant cause of Leigh Syndrome, a progressive neurological disorder . The typical clinical presentation involves developmental regression, motor and mental retardation, and lesions in the brainstem and basal ganglia .

3.2. Symptoms and Manifestations

The mean onset of symptoms occurs around 16 months of age, with diagnosis taking an average of 28 months from the onset of symptoms . Common initial symptoms include gross motor delay, intellectual disability, ataxia, hypotonia, and visual abnormalities . Some patients may also exhibit peripheral neuropathy .

3.3. Diagnostic Findings

Key diagnostic indicators of SURF1 deficiency include elevated lactate levels in cerebrospinal fluid (CSF) and blood, as well as decreased COX activity in fibroblasts . Neuroimaging often reveals lesions characteristic of LS .

  • Elevated CSF Lactate: A mean of 4.3 mmol/L in all patients tested

  • Elevated Blood Lactate: A mean of 4.4 mmol/L in 81% of patients

  • Decreased Fibroblast COX Activity: Universally observed in tested patients

3.4. Natural History and Survival

SURF1-deficient patients experience variable survival rates, with a median survival of approximately 5.4 years . Understanding the natural history of SURF1 deficiency is crucial for designing future clinical trials and potential gene therapies .

4.1. SURF4

SURF4 is identified as a cargo receptor that facilitates PCSK9 secretion . Hepatic inactivation of murine Surf4 results in a marked reduction in plasma cholesterol .

4.2. NEK4

N-[2-(substituted-phenyl)ethyl]-6-fluoro-4-quinazolinamines have been found as never in mitosis A related kinase 4 (NEK4) inhibitors . These analogues are significantly more effective towards EGFR-mutant NSCLC cells than Spautin-1 and act as potent NEK4 inhibitors (IC 50~1 µM) with moderate selectivity over other kinases .

5.1. Mutational Spectrum

Genetic analysis of SURF1-deficient patients reveals a variety of mutations, including missense, nonsense, and frameshift mutations . The identification of these mutations is essential for confirming the diagnosis of SURF1 deficiency.

5.2. Diagnostic Challenges

Delays in diagnosis are common, highlighting the need for increased awareness and early screening for SURF1 deficiency in patients presenting with relevant clinical features .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a particular tag type is required, please inform us for preferential development.
Synonyms
SURF1; SURF-1; Surfeit locus protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SURF1
Target Protein Sequence
MAAVAALQLGLRAAGLGRAPASAAWRSVLRVSPRPGVAWRPSRCGSSAAEASATKAEDDS FLQWVLLLIPVTAFGLGTWQVQRRKWKLNLIAELESRVLAEPVPLPADPMELKNLEYRPV KVRGCFDHSKELYMMPRTMVDPVREAREGGLISSSTQSGAYVVTPFHCTDLGVTILVNRG FVPRKKVNPETRQKGQIEGEVDLIGMVRLTETRQPFVPENNPERNHWHYRDLEAMARITG AEPIFIDANFQSTVPGGPIGGQTRVTLRNEHLQYIVTWYGLSAATSYLWFKKFLRGTPGV
Uniprot No.

Target Background

Function

Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex), regulating cytochrome c oxidase assembly.

Gene References Into Functions
SURF1 Gene and Related Research:

The following publications highlight the significance of SURF1 and its association with various conditions:
  • SURF1 mutations and clinical outcomes in Leigh syndrome (PMID: 29933018)
  • SURF1 gene screening in Tunisian Leigh syndrome patients (PMID: 29481804)
  • SURF1 mutations in Charcot-Marie-Tooth disease (PMID: 24027061)
  • Hypertrophic olivary degeneration in mitochondrial syndromes related to SURF1 mutations (PMID: 22729384)
  • Identification of SURF1 mutations in Leigh syndrome patients (PMID: 22410471)
  • Clinical features of Leigh syndrome and SURF1 mutations (PMID: 22488715)
  • Analysis of fibroblast cell lines from SURF1 mutation patients (PMID: 22465034)
  • Identification of Coa4, a new cytochrome oxidase assembly factor, through SURF1 homolog analysis (PMID: 20624914)
  • SURF1 mutations in the Russian population (PMID: 20436434)
  • Novel SURF1 mutations in Japanese patients with cytochrome c oxidase deficiency (PMID: 11955926)
  • A new missense mutation in the SURF1 gene in Leigh syndrome (PMID: 12515039)
  • Novel pathogenic SURF1 mutations identified in Leigh syndrome (PMID: 12538779)
  • SURF1 mutations and cytochrome c oxidase-deficient Leigh syndrome (PMID: 12812953)
  • Pathogenic SURF1 mutations in Leigh syndrome (PMID: 14557577)
  • Role of SURF1 in cytochrome c oxidase assembly (PMID: 14607829)
  • Potential role of SURF1 mutation in subacute encephalopathy (PMID: 15214016)
  • Role of Surf1p in heme a insertion into cytochrome-c oxidase (PMID: 15764605)
  • Tissue-specific functional differences of SCO2 and SURF1 (PMID: 16083427)
  • Histological and histochemical features of SURF1-deficient Leigh syndrome muscle (PMID: 17908801)
  • Prevalence of SURF1 c.845_846delCT mutation in Polish Leigh patients (PMID: 18583168)
  • Role of Surf1 in copper homeostasis regulation (PMID: 19295170)
  • Direct role of Surf1 in heme a cofactor insertion (PMID: 19625251)
  • Correlation between SURF1 missense mutation and milder Leigh syndrome course (PMID: 19780766)
Show More Show Less
Database Links

HGNC: 11474

OMIM: 185620

KEGG: hsa:6834

STRING: 9606.ENSP00000361042

UniGene: Hs.512464

Involvement In Disease
Leigh syndrome (LS); Charcot-Marie-Tooth disease 4K (CMT4K)
Protein Families
SURF1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic molecular structure of human SURF1 protein?

Human SURF1 is a transmembrane protein involved in the assembly of cytochrome c oxidase (COX), a critical component of the mitochondrial respiratory chain. The SURF1 gene is located within the Surfeit locus on chromosome 9, which contains six sequence-unrelated housekeeping genes (SURF1-SURF6) organized in a tightly clustered arrangement spanning approximately 60 kb of DNA . The protein possesses two predicted transmembrane helices with conserved amino acid residues clustered around their periplasmic sides. A highly conserved histidine residue in the C-terminal helix (H193 in Surf1c and H202 in Surf1q bacterial homologs) has been identified as crucial for heme a binding .

What is the primary function of SURF1 in mitochondrial processes?

SURF1 functions as a critical assembly factor for cytochrome c oxidase (COX), directly participating in heme a cofactor insertion into COX subunit I. Research using bacterial homologs (Surf1c and Surf1q from Paracoccus denitrificans) has demonstrated that SURF1 binds heme a with high affinity (Kd values in the submicromolar range) in a 1:1 stoichiometry . This binding appears to serve three key functions in COX biogenesis:

  • Modulating heme synthase activity by abstracting heme a from the active site

  • Providing a safe, readily available pool of heme a cofactor

  • Chaperoning heme a to its target sites in COX subunit I for presumed co-translational insertion

What are the optimal expression systems for producing recombinant human SURF1?

For recombinant SURF1 expression, bacterial systems have proven effective for studying homologous proteins. Based on experimental protocols with bacterial Surf1 homologs, co-expression with enzymes for heme a synthesis (CtaA and CtaB in the case of P. denitrificans homologs) is critical when aiming to obtain heme a-bound SURF1 protein . When expressing human SURF1, researchers should consider:

  • Codon optimization: Human codon usage differs significantly from E. coli, potentially necessitating codon optimization

  • Expression conditions: Parameters should be carefully controlled with lower temperatures (16-20°C) often yielding better results for membrane proteins

  • Purification strategy: A two-step chromatography approach beginning with affinity purification followed by size exclusion chromatography has been successfully employed with bacterial homologs

What spectroscopic methods are most effective for analyzing SURF1-heme interactions?

Several complementary spectroscopic techniques have proven valuable for studying SURF1-heme interactions:

  • Redox difference spectroscopy: This method can identify bound heme a through characteristic absorption peaks. In bacterial Surf1 homologs, heme a presents a prominent peak at 587 nm in pyridine redox spectra and absorption maxima at 595-600 nm in native redox spectra .

  • Native vs. denatured conditions: Comparing spectra under native and denaturing conditions provides insights into the nature of heme binding. Under denaturing conditions, heme a in bacterial Surf1 homologs shows a prominent peak at 587 nm, while under native conditions, the absorption maximum shifts to 595-600 nm .

  • Titration experiments: Spectral shifts during titration of apo-SURF1 with heme a solution can demonstrate specific binding. A distinct red shift of the heme signal from 412 to 419 nm in the oxidized form indicates specific binding to Surf1 .

Spectroscopic MethodKey Information ObtainedCharacteristic Signal for SURF1-heme a
Pyridine redox spectraHeme a identificationProminent peak at 587 nm
Native redox spectraBound heme a characterizationAbsorption maximum at 595-600 nm
Oxidized state spectraBinding confirmationShift from 412 to 419 nm upon binding

How can isothermal titration calorimetry (ITC) be utilized to quantify SURF1-heme binding parameters?

ITC provides valuable quantitative information about SURF1-heme binding thermodynamics. Based on studies with bacterial homologs:

  • Experimental setup: Titrate a heme a solution into purified apo-SURF1 (expressed without heme a synthesis enzymes) under controlled temperature conditions.

  • Data analysis approach: The binding stoichiometry, dissociation constant (Kd), binding enthalpy (ΔH), and entropy changes (ΔS) can be determined through curve fitting of heat changes.

  • Expected parameters: With bacterial Surf1 homologs, binding stoichiometry is approximately 1:1, with Kd values in the submicromolar range (303 nM for Surf1c and 650 nM for Surf1q) .

  • Thermodynamic profile: Binding is strongly exothermic with an entropic cost. Different SURF1 variants may show significant differences in binding enthalpy, reflecting different polar interactions with the heme cofactor .

ParameterSurf1c (Wild-type)Surf1c (H193A variant)Surf1q (Wild-type)Surf1q (H202A variant)
Kd (nM)303~3,330 (11-fold ↑)650~1,950 (3-fold ↑)
ΔH (kcal/mol)-21.1-10.5-11.6Similar to wild-type

What mutagenesis strategies can identify critical residues for SURF1 function?

Site-directed mutagenesis provides powerful insights into structure-function relationships in SURF1:

  • Target selection: Focus on highly conserved residues identified through sequence alignments of SURF1 homologs across species. Priority should be given to residues clustered around the periplasmic sides of the two predicted transmembrane helices .

  • Critical histidine residue: The conserved histidine in the C-terminal helix (equivalent to H193 in Surf1c and H202 in Surf1q) is particularly important. Alanine substitution at this position dramatically reduces heme a binding capacity, suggesting this histidine directly ligands the heme a metal ion .

  • Functional assessment: After mutagenesis, assess:

    • Protein expression and stability

    • Heme a binding capacity through spectroscopic methods

    • Binding thermodynamics via ITC

    • Functional complementation in SURF1-deficient systems

  • Data interpretation: Compare wild-type and variant proteins across multiple parameters. For instance, the H193A variant of Surf1c shows both reduced binding affinity (~11-fold increase in Kd) and dramatically altered binding enthalpy, whereas the equivalent H202A variant in Surf1q shows a milder effect .

How does SURF1 deficiency manifest in Leigh syndrome, and what are the implications for therapeutic development?

SURF1 deficiency is the most frequent cause of cytochrome c oxidase (COX) deficient Leigh syndrome (LS), a severe neurodegenerative disorder . Understanding this connection has important research implications:

  • Clinical presentation: SURF1-deficient Leigh syndrome typically presents with early onset in infancy, with symptoms manifesting in the basal ganglia, thalamus, brainstem, cerebellum, and peripheral nerves . Biochemical markers include elevated lactate in cerebrospinal fluid (mean 4.3 mmol/L) and blood (mean 4.4 mmol/L) in most patients .

  • Diagnostic approach:

    • Universal decrease in fibroblast COX activity

    • Reduced muscle COX activity in 96% of cases

    • Characteristic LS lesions on neuroimaging in 85% of patients

    • Peripheral neuropathy in 81% of patients (predominantly demyelinating)

  • Survival data: SURF1-deficient patients demonstrate longer survival (median 5.4 years) compared to other genetically defined forms of LS .

  • Therapeutic implications: The elucidation of SURF1's role in heme a binding and transport suggests potential therapeutic avenues:

    • Approaches to enhance residual COX assembly

    • Development of heme a delivery strategies

    • Gene therapy to restore functional SURF1 expression

What is the relationship between SURF1 mutations and COX assembly defects in patient tissues?

The relationship between SURF1 mutations and COX deficiency involves complex biochemical mechanisms:

How can researchers effectively design experiments to study the co-translational insertion of heme a via SURF1?

Studying co-translational heme a insertion through SURF1 requires sophisticated experimental approaches:

  • Cell-free translation systems: Design experiments utilizing in vitro translation of COX subunit I in the presence of purified SURF1 and heme a to directly observe co-translational insertion. This can be monitored using:

    • Fluorescently labeled heme analogs

    • Real-time spectroscopic detection

    • Crosslinking strategies to capture transient interactions

  • Pulse-chase experiments: In cellular systems, synchronized translation followed by timed addition of labeled heme precursors can reveal the temporal relationship between protein synthesis and heme incorporation.

  • Ribosome profiling: This technique can identify translation pausing at sites of heme insertion, potentially revealing the coordination between SURF1, nascent COX subunit I, and heme a delivery.

  • Reconstitution systems: Establish minimal systems containing the essential components for COX assembly (including SURF1 and heme a synthesis machinery) to study the process under controlled conditions.

What are the current methodological challenges in resolving SURF1's structure and how might they be overcome?

Structural determination of membrane proteins like SURF1 presents several challenges:

  • Expression and purification obstacles:

    • Low natural abundance requires recombinant expression

    • Maintaining proper folding during detergent solubilization

    • Preserving heme binding capacity throughout purification

    Solution approach: Screen multiple expression systems, detergents, and stabilizing conditions. Consider fusion partners or thermostabilizing mutations.

  • Crystallization difficulties:

    • Conformational heterogeneity

    • Detergent micelle interference

    • Potential flexibility in transmembrane regions

    Solution approach: Utilize lipidic cubic phase crystallization, stabilize with antibody fragments, or employ nanobodies to rigidify flexible regions.

  • Alternative structural approaches:

    • Cryo-electron microscopy (cryo-EM) with amphipols or nanodiscs

    • NMR spectroscopy for specific domains or with selective labeling

    • Integrative modeling combining low-resolution data with computational approaches

  • Functional state capture:

    • SURF1 may adopt different conformations during heme binding and release

    • Capturing these transient states is challenging

    Solution approach: Engineer disulfide bonds to trap specific conformations or utilize heme analogs that stabilize particular states.

How can researchers reconcile conflicting data regarding SURF1's precise role in COX assembly?

Conflicting interpretations of SURF1's function require careful experimental design and data analysis:

  • Comparative analysis of model systems:

    • Different model organisms (yeast, bacteria, human cells) show variations in COX assembly mechanisms

    • The yeast homolog (Shy1p) has additional structural features not found in other SURF1 proteins

    • Bacterial systems (P. denitrificans) demonstrate direct heme a binding, while evidence in human cells is more indirect

    Reconciliation approach: Design parallel experiments in multiple systems with standardized methodologies to directly compare results.

  • Temporal aspects of SURF1 function:

    • Some data suggest early co-translational involvement

    • Other evidence indicates association with later assembly intermediates

    Reconciliation approach: Develop time-resolved analysis of COX assembly using synchronized cells and pulse-chase techniques.

  • Alternative functions beyond heme transport:

    • Evidence for regulatory roles

    • Potential interactions with other assembly factors

    • Possible quality control functions

    Reconciliation approach: Comprehensive interactome analysis coupled with functional studies of each interaction.

  • Clinical data interpretation:

    • Variable severity of COX deficiency across tissues in SURF1-deficient patients

    • Some mutations cause Leigh syndrome while others have milder phenotypes

    Reconciliation approach: Correlate biochemical parameters with specific mutations and their consequences for protein structure and function.

What bioinformatic approaches are most effective for analyzing evolutionary conservation of SURF1 function across species?

Understanding SURF1 evolution requires sophisticated bioinformatic analysis:

  • Sequence-based approaches:

    • Multiple sequence alignment across diverse species

    • Identification of absolutely conserved residues versus lineage-specific changes

    • Calculation of conservation scores using methods like ConSurf

    Key focus: Pay particular attention to the regions around transmembrane domains where conserved functional residues cluster, especially the critical histidine residue shown to be essential for heme binding .

  • Structural homology modeling:

    • Generate structural models of SURF1 from diverse species

    • Analyze conservation of binding pockets and interaction surfaces

    • Predict functional consequences of evolutionary changes

    Application: Map conserved residues onto structural models to identify potential functional sites beyond those already characterized.

  • Co-evolution analysis:

    • Identify co-evolving residues within SURF1

    • Analyze co-evolution between SURF1 and its interaction partners

    • Predict functional interactions based on evolutionary coupling

    Implementation: Tools like GREMLIN or EVcouplings can identify residue pairs that have co-evolved, suggesting functional or structural relationships.

  • Phylogenetic profiling:

    • Compare the presence/absence of SURF1 with other COX assembly factors

    • Identify organisms with alternative assembly pathways

    • Analyze evolutionary rate differences across lineages

    Interpretation: Correlate evolutionary patterns with differences in mitochondrial function and energy metabolism across species.

What novel experimental approaches could elucidate the dynamic interactions between SURF1 and other COX assembly factors?

Emerging technologies offer new opportunities to probe SURF1's interactions:

  • Proximity labeling techniques:

    • BioID, TurboID, or APEX2 fusions to SURF1 can identify proximal proteins

    • Time-resolved proximity labeling during induced COX assembly

    • Comparative analysis in wild-type versus pathogenic SURF1 variants

    Expected outputs: Identification of transient interactions during different phases of COX assembly that may not be captured by traditional co-immunoprecipitation.

  • Single-molecule imaging approaches:

    • Fluorescently labeled SURF1 tracking in live cells

    • Simultaneous imaging of multiple assembly factors

    • Super-resolution microscopy to track assembly factor clustering

    Analytical approach: Quantify co-localization, diffusion rates, and interaction dynamics in different cellular compartments.

  • Reconstituted systems in lipid nanodiscs:

    • Step-wise reconstitution of assembly intermediates

    • Direct measurement of protein-protein and protein-lipid interactions

    • Controlled addition of assembly factors to study sequential events

    Experimental readouts: Spectroscopic changes, binding kinetics, and structural alterations during complex formation.

  • Hydrogen-deuterium exchange mass spectrometry:

    • Map interaction surfaces between SURF1 and other assembly factors

    • Identify conformational changes upon binding

    • Characterize differences between wild-type and disease-associated variants

    Data analysis focus: Differential exposure patterns that reveal dynamic structural adaptations during functional interactions.

How might high-throughput drug screening approaches be optimized to identify compounds that enhance residual SURF1 function in disease models?

Developing therapeutics for SURF1 deficiency requires specialized screening approaches:

  • Disease model selection:

    • Patient-derived fibroblasts carrying different SURF1 mutations

    • CRISPR-engineered cell lines with specific pathogenic variants

    • Animal models (mouse, zebrafish) with SURF1 deficiency

    • Yeast models expressing human SURF1 variants

    Design consideration: Include models with different mutations to identify mutation-specific versus general therapeutic strategies.

  • High-content screening readouts:

    • COX activity measurement by respirometry or enzyme assays

    • Mitochondrial membrane potential using fluorescent indicators

    • ATP production rates under different substrate conditions

    • Reactive oxygen species levels as indicators of electron transport chain dysfunction

    Optimization approach: Develop plate-compatible, scalable assays with sufficient dynamic range to detect partial functional recovery.

  • Compound library selection:

    • FDA-approved drug libraries for repurposing potential

    • Natural product collections enriched for mitochondrial modulators

    • Targeted libraries of heme metabolism modulators

    • Chaperone-enhancing compounds that might stabilize SURF1 variants

    Screening strategy: Implement a tiered approach beginning with broader libraries and then focusing on chemical classes showing preliminary efficacy.

  • Data integration and analysis:

    • Machine learning to identify structural features of active compounds

    • Pathway analysis to understand mechanisms of action

    • Integration with transcriptomic responses to identify indirect effects

    • Structure-activity relationship development for hit optimization

    Validation approach: Confirm primary hits with orthogonal assays and dose-response studies before proceeding to mechanistic investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.