Recombinant Human Surfeit locus protein 4 (SURF4)

Shipped with Ice Packs
In Stock

Description

Protein Trafficking and ER Export

  • Cargo Receptor Role: SURF4 mediates ER-to-Golgi transport of soluble proteins (e.g., proinsulin, lipoproteins) by recruiting them into COPII vesicles .

  • Mechanism: Interaction with GTPase SAR1B enhances vesicle formation, while oligomerization stabilizes cargo loading .

  • Key Substrates:

    • Apolipoproteins (APOB, APOA1)

    • Proinsulin

    • PCSK9 and erythropoietin (EPO)

Lipid Metabolism Regulation

  • Hepatic Function: SURF4 knockdown reduces plasma cholesterol and triglycerides by impairing VLDL secretion .

  • Intestinal Role: Silencing intestinal SURF4 in mice causes lipid accumulation, ER stress, and reduced chylomicron secretion, leading to hypolipidemia .

Disease Implications

  • Cancer: SURF4 overexpression in oral squamous cell carcinoma (OSCC) drives aerobic glycolysis, enhancing tumor proliferation and metastasis .

  • Metabolic Disorders: SURF4 deficiency is linked to dyslipidemia and chylomicron retention diseases .

In Vitro and In Vivo Studies

Study ModelKey FindingsCitation
OSCC Cell LinesSURF4 overexpression increases glucose consumption, lactate production, and stemness markers (OCT-4, SOX-2) .
Intestinal-Specific SURF4 Knockout MiceImpaired lipid absorption, ER lipid vacuole accumulation, and reduced serum triglycerides .
INS-1 832/13 Pancreatic CellsSURF4 interacts with proinsulin and COPII components (Sec12, Sec23) to regulate insulin secretion .

Mechanistic Insights

  • ER-ESCAPE Motif Binding: SURF4 recognizes tripeptides like DPL (DSPP) and ARM (AMELX) to prioritize cargo export .

  • COPII Coordination: SURF4 colocalizes with Sec12 and Sec23 at ER exit sites, promoting vesicle assembly .

Applications in Research

  • Protein Interaction Studies: Used to map SURF4-cargo binding (e.g., apoB48 in Caco-2 cells) .

  • Disease Modeling:

    • Cancer: SURF4’s role in OSCC glycolysis offers therapeutic target potential .

    • Metabolic Diseases: SURF4 inhibitors may treat atherosclerosis and hyperlipidemia .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery estimates.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Typically, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form maintains its stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SURF4; SURF-4; Surfeit locus protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SURF4
Target Protein Sequence
MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWN CGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFF SIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW
Uniprot No.

Target Background

Function
SURF4 is an endoplasmic reticulum cargo receptor that facilitates the export of lipoproteins by recruiting cargo into COPII vesicles, enabling their secretion. It serves as a cargo receptor for lipoproteins containing both APOB and APOA1, thereby regulating lipoprotein delivery and maintaining lipid homeostasis. It collaborates with the GTPase SAR1B to mediate the transport of circulating lipoproteins. SURF4 promotes the secretion of PCSK9 and facilitates the efficient secretion of erythropoietin (EPO). It may also play a role in maintaining the architecture of the endoplasmic reticulum-Golgi intermediate compartment and the Golgi apparatus.
Gene References Into Functions
  1. SURF4 exhibited aberrant amplification and increased expression in the tumor tissues of several human cancer patients. PMID: 29777698
  2. Silencing Surf4 in conjunction with ERGIC-53 or silencing the p24 family member p25 induced an identical phenotype characterized by a reduced number of ERGIC clusters and fragmentation of the Golgi apparatus, without affecting anterograde transport. PMID: 18287528
Database Links

HGNC: 11476

OMIM: 185660

KEGG: hsa:6836

STRING: 9606.ENSP00000361057

UniGene: Hs.512465

Protein Families
SURF4 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is SURF4 and what are its primary functions?

SURF4 is a ubiquitously expressed cargo receptor protein located in the ER membrane that facilitates the export of diverse secretory proteins through vesicle or tubular transport systems . Its primary functions include:

  • Mediating VLDL secretion from hepatocytes by directly interacting with apoB-100

  • Facilitating chylomicron secretion from intestinal epithelial cells through interaction with apoB48

  • Serving as a cargo receptor for various secretory proteins including PCSK9, Cab45, and NUCB1

  • Connecting lumenal cargo to the cytosolic COPII coat complex for efficient ER export

SURF4 is essential for maintaining lipid homeostasis, as demonstrated by studies showing that intestinal-specific SURF4 knockdown (SURF4 IKO) mice exhibit significant reductions in serum triglyceride, cholesterol, and free fatty acid levels .

How does SURF4 deficiency affect lipid metabolism in animal models?

Intestinal-specific SURF4 deficiency produces several significant metabolic effects:

  • Male SURF4 IKO mice exhibit more pronounced body weight loss and increased mortality compared to female counterparts

  • Both male and female SURF4 IKO mice display impaired fat absorption and secretion

  • Electron microscopy reveals accumulation of lipid droplets in the cytosol and small lipid vacuoles in the ER lumen of enterocytes in SURF4 IKO mice

  • Instead of normal chylomicron-like vacuoles (diameter: 249±27.893 nm), SURF4-deficient villi show smaller pre-chylomicron-like vacuoles (diameter: 103.57±17 nm) in the ER lumen

  • SURF4 IKO mice exhibit decreased liver size and weight, along with reduced hepatic triglyceride levels

  • Proteomics data show altered expression of proteins involved in cholesterol metabolism and lipoprotein particles in SURF4 IKO mice

These findings demonstrate that intestinal SURF4 plays an essential role in dietary lipid absorption and chylomicron secretion, affecting systemic lipid metabolism.

What structural domains of SURF4 are essential for its cargo binding function?

SURF4 contains a highly conserved lumenal domain that is responsible for binding to ER-ESCAPE motifs on cargo proteins . Key structural features include:

  • A lumenal pocket that interacts with client proteins containing ER-ESCAPE motifs

  • Cytosolic domains that engage with SEC24 adaptor proteins via the B-site

  • Potential co-receptor binding regions that facilitate interactions with proteins like TMED10

The interaction between SURF4 and SEC24 is primarily driven by the conserved B-site, as demonstrated by experiments showing reduced interaction when this site is mutated . Additionally, it has been proposed that SURF4 engages SEC24 via an FF motif located near its C-terminus, though research continues to elucidate the complete structural basis of these interactions .

How can researchers effectively generate and validate SURF4 knockout models?

To generate and validate effective SURF4 knockout models, researchers should consider the following methodological approach:

  • Design Strategy: For tissue-specific knockdown, use Cre-loxP recombination systems with tissue-specific promoters. For intestinal-specific knockdown, the Vil1Cre-ER^T2^ system can be employed, as demonstrated in recent studies .

  • Knockout Verification:

    • Confirm genotyping by PCR to detect the presence of loxP sites and Cre recombinase

    • Validate protein knockdown through Western blot analysis of tissue lysates

    • Verify tissue specificity by examining SURF4 expression in various organs through qRT-PCR

  • Phenotypic Analysis:

    • Monitor body weight and mortality rates

    • Analyze metabolic parameters using metabolic cages

    • Measure serum and tissue lipid levels with enzymatic kits

    • Assess intestinal lipid absorption using radiolabeled lipids (e.g., [^3^H]-labeled oleic acid)

  • Structural Analysis:

    • Employ transmission electron microscopy (TEM) to examine enterocyte ultrastructure

    • Compare chylomicron size and distribution between knockout and control animals

Care should be taken to analyze both male and female models separately, as sex-specific differences in SURF4 knockdown efficacy and phenotypic outcomes have been observed .

What experimental approaches best demonstrate SURF4's interaction with client proteins and the COPII machinery?

Several complementary techniques can effectively demonstrate SURF4's interactions with client proteins and COPII components:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-SURF4 antibodies to pull down protein complexes from cell lysates

    • Analyze by Western blot using antibodies against suspected binding partners (e.g., apoB48)

    • Include appropriate controls (non-immune IgG) to validate specific interactions

  • Confocal Microscopy for Colocalization:

    • Employ fluorescently labeled antibodies against SURF4 and potential client proteins

    • Quantify colocalization using standard statistical measures

    • Compare colocalization under different conditions (e.g., with and without oleic acid stimulation)

  • Protein-Protein Interaction Assays:

    • Utilize NanoBiT (NanoLuciferase Binary Technology) to assess interactions in living cells

    • Test interactions between SURF4 and SEC24 paralogs

    • Introduce site-specific mutations to identify critical binding domains

  • Pharmacological Inhibition:

    • Apply B-site inhibitors (e.g., 4-PBA) at increasing concentrations to validate interaction mechanisms

    • Measure dose-dependent effects on protein-protein interactions

  • Co-translational Binding Analysis:

    • Design ribosome profiling experiments to detect nascent chain interactions

    • Compare binding kinetics before and after signal peptide cleavage

Each approach provides complementary information about SURF4's interaction network, with co-IP and colocalization studies establishing physical association, while functional assays like NanoBiT provide insights into the dynamics of these interactions.

How can researchers analyze the differential roles of SURF4 in diverse secretory pathways?

To analyze SURF4's differential roles in various secretory pathways, researchers should implement the following methodological framework:

  • Cargo-Specific Secretion Assays:

    • Measure secretion of model proteins (e.g., PCSK9, Cab45, NUCB1) in SURF4-depleted cells

    • Quantify intracellular retention versus secretion rates for each cargo

    • Compare lipid-based cargoes (apoB-containing lipoproteins) with soluble protein secretion

  • SEC24 Paralog-Specific Analysis:

    • Perform selective knockdown of individual SEC24 paralogs (A, B, C, D)

    • Analyze effects on different SURF4-dependent cargoes

    • Create rescue experiments with wild-type versus mutant SEC24 constructs

  • Co-receptor Dependency Studies:

    • Investigate potential co-receptors (e.g., TMED10) for specific cargoes

    • Perform co-depletion experiments of SURF4 and suspected co-receptors

    • Analyze synergistic versus additive effects on cargo secretion

  • Client Binding Motif Mapping:

    • Use mutagenesis to alter putative ER-ESCAPE motifs in client proteins

    • Measure binding affinity to SURF4 through co-IP or surface plasmon resonance

    • Correlate motif strength with secretion efficiency

  • Temporal Analysis of Cargo Engagement:

    • Employ pulse-chase experiments to determine timing of SURF4-cargo interactions

    • Distinguish between co-translational and post-translational binding mechanisms

    • Correlate timing with cargo characteristics (e.g., Ca^2+-binding proteins versus proteases)

This multi-faceted approach allows researchers to dissect the complex mechanisms by which SURF4 facilitates the export of different cargo classes through distinct pathways.

How should researchers design experiments to investigate SURF4's role in lipoprotein assembly?

When investigating SURF4's role in lipoprotein assembly, researchers should consider the following experimental design elements:

  • Cell Model Selection:

    • For intestinal lipoprotein studies: Differentiated Caco-2 cells provide an established enterocyte model

    • For hepatic lipoprotein studies: HepG2 or primary hepatocytes are appropriate

    • Consider complementing in vitro studies with in vivo models using tissue-specific knockouts

  • Stimulation Conditions:

    • Induce lipoprotein production with oleic acid treatment (typical concentration: 0.4 mM)

    • Include appropriate time course analysis (4-24 hours) to capture assembly dynamics

    • Control for potential cytotoxicity at higher lipid concentrations

  • Analytical Methods:

    • Quantify intracellular lipid accumulation using Oil Red O staining or triglyceride assays

    • Measure apoB secretion via ELISA or Western blotting of culture media

    • Characterize lipoprotein particle size distribution using gradient ultracentrifugation

  • Subcellular Localization Studies:

    • Track lipid droplet formation using BODIPY or Nile Red staining

    • Monitor ER-to-Golgi trafficking using live-cell imaging of fluorescently tagged markers

    • Perform immunogold electron microscopy to localize SURF4 and apoB in relation to lipid structures

  • Intervention Studies:

    • Compare the effects of SURF4 knockdown versus overexpression

    • Introduce wild-type versus mutant SURF4 constructs for rescue experiments

    • Apply pharmacological inhibitors of specific trafficking steps

By systematically addressing these experimental considerations, researchers can effectively dissect SURF4's specific contributions to the complex process of lipoprotein assembly and secretion.

What controls and validation steps are essential when studying SURF4-SEC24 interactions?

When investigating SURF4-SEC24 interactions, the following controls and validation steps are essential:

  • Expression Control Validations:

    • Verify protein expression levels of both SURF4 and SEC24 paralogs by Western blot

    • Ensure comparable expression levels when comparing different SEC24 paralogs

    • Validate mutant protein stability to confirm that reduced interaction is not due to protein degradation

  • Interaction Specificity Controls:

    • Include negative controls (unrelated transmembrane proteins) in interaction assays

    • Perform reciprocal co-IP experiments (pull-down with anti-SEC24 and probe for SURF4)

    • Test interaction with other COPII components (Sec23, Sar1) as specificity controls

  • Domain Mutation Validation:

    • Create targeted mutations in predicted interaction domains:

      • B-site mutations in SEC24

      • Cytosolic domain mutations in SURF4

    • Compare multiple independent mutations affecting the same domain

    • Include mutations in non-critical regions as negative controls

  • Functional Validation:

    • Correlate protein-protein interaction data with functional secretion assays

    • Confirm that interaction-deficient mutants also show functional defects

    • Perform dose-response studies with competitive inhibitors (e.g., 4-PBA)

  • Localization Validation:

    • Confirm proper localization of mutant proteins to relevant compartments

    • Ensure that mutations don't cause misfolding or aggregation

    • Verify that SEC24 mutants still incorporate into COPII vesicles

These rigorous controls ensure that observed interactions are specific and physiologically relevant, reducing the risk of artifacts or misinterpretation of results.

How can researchers troubleshoot inconsistent results in SURF4 knockout phenotypes?

When facing inconsistent results in SURF4 knockout phenotypes, researchers should systematically address these potential sources of variation:

  • Knockout Efficiency Variability:

    • Quantify residual SURF4 mRNA and protein levels in each experimental cohort

    • Note that female Surf4 IKO mice show higher residual expression than males

    • Stratify analysis based on knockout efficiency if variability is detected

  • Sex-Specific Differences:

    • Analyze male and female models separately, as phenotypic differences have been documented

    • Match age and reproductive status when comparing across studies

    • Consider hormonal influences on lipid metabolism as potential confounding factors

  • Genetic Background Effects:

    • Maintain consistent genetic backgrounds across experiments

    • Backcross to achieve congenic strains if mixed backgrounds were used initially

    • Consider testing phenotypes in multiple genetic backgrounds to assess robustness

  • Environmental Variables:

    • Standardize housing conditions, diet, and light cycles

    • Control for potential microbiome differences, especially in intestinal studies

    • Document and control feeding status prior to experiments (fasting vs. fed state)

  • Technical Considerations:

    • Optimize tamoxifen induction protocols for consistent Cre activation

    • Establish clear timepoints post-induction for analysis (acute vs. chronic effects)

    • Standardize tissue collection and processing methods

  • Compensatory Mechanisms:

    • Investigate potential upregulation of related proteins (e.g., other cargo receptors)

    • Consider acute (short-term) versus chronic (long-term) knockout effects

    • Perform time-course analyses to detect adaptive responses

By systematically addressing these potential sources of variability, researchers can better reconcile inconsistent results and develop more robust experimental designs for future studies.

How should researchers interpret proteomics data from SURF4-deficient models?

When interpreting proteomics data from SURF4-deficient models, researchers should follow these analytical guidelines:

  • Pathway Enrichment Analysis:

    • Apply multiple pathway analysis tools (KEGG, Gene Ontology, Reactome)

    • Prioritize consistently enriched pathways across different analyses

    • Note that SURF4 IKO mice show enrichment in cholesterol metabolism pathways and amoebiasis (suggesting intestinal damage)

  • Cargo Classification:

    • Categorize differentially expressed proteins by:

      • Secretory versus non-secretory proteins

      • Known versus potential SURF4 clients

      • Functional protein families (e.g., proteases, Ca^2+-binding proteins)

    • Look for patterns in specific protein classes affected

  • Direct versus Indirect Effects:

    • Distinguish primary effects (direct SURF4 clients) from secondary adaptations

    • Consider that few known SURF4 substrates may be directly affected, while many changes could be compensatory

    • For example, apoA-I upregulation in SURF4 IKO intestine may represent a compensatory response

  • Subcellular Compartment Analysis:

    • Analyze enrichment patterns by subcellular location (e.g., ER, Golgi, secretory vesicles)

    • Pay particular attention to lipoprotein particles, which show significant alterations in SURF4 IKO mice

    • Correlate proteomics findings with ultrastructural observations

  • Temporal Considerations:

    • When possible, collect samples at multiple timepoints post-knockout

    • Early changes may reflect direct trafficking defects

    • Later changes often represent adaptive responses to cellular stress

  • Validation of Key Findings:

    • Confirm critical proteomics hits by orthogonal methods (Western blot, qPCR)

    • Functionally test whether altered proteins represent direct SURF4 clients

    • Investigate mechanisms connecting SURF4 deficiency to observed protein changes

This structured approach helps distinguish direct effects of SURF4 deficiency from secondary adaptations and identifies the most relevant pathways affected by SURF4 dysfunction.

What are the key considerations for analyzing SURF4's role in co-translational versus post-translational cargo binding?

When analyzing SURF4's role in co-translational versus post-translational cargo binding, researchers should consider these key factors:

  • Temporal Binding Analysis:

    • Design experiments that can distinguish when cargo association occurs relative to translation

    • Utilize ribosome profiling or nascent chain capture methods to detect co-translational binding

    • Compare binding kinetics before and after signal peptide cleavage, which has been shown to expose the ER-ESCAPE motif in some proteins

  • Client Protein Classification:

    • Analyze whether specific classes of proteins preferentially use co-translational binding:

      • Ca^2+-binding proteins (e.g., Cab45, NUCB1) appear to bind co-translationally

      • Determine if other functional categories show similar binding patterns

    • Correlate binding mode with protein characteristics (size, folding complexity, post-translational modifications)

  • Biological Significance Assessment:

    • Investigate the functional consequences of different binding modes

    • Test the hypothesis that co-translational binding represents a "fast-track" export mechanism

    • Evaluate whether co-translational binding protects the ER from potentially harmful proteins (e.g., Ca^2+-sequestering proteins)

  • Mechanistic Determinants:

    • Identify sequence or structural features that determine binding mode

    • Test whether signal peptide characteristics influence co-translational binding probability

    • Explore the role of ER-ESCAPE motif accessibility in determining binding timing

  • Experimental Approach Considerations:

    • Design mutations that specifically disrupt co-translational binding without affecting post-translational interactions

    • Employ synchronization methods to capture transient co-translational interactions

    • Use real-time imaging techniques to visualize binding dynamics in living cells

Understanding these distinctions has important implications for protein quality control and ER homeostasis, as co-translational binding may represent a mechanism to rapidly export specific classes of proteins that could otherwise disrupt ER function.

How can researchers reconcile in vitro and in vivo findings regarding SURF4 function?

To reconcile potential discrepancies between in vitro and in vivo findings regarding SURF4 function, researchers should employ the following analytical framework:

  • Model System Comparison:

    • Acknowledge inherent differences between cell lines and intact tissues:

      • Caco-2 cells express both apoB-100 and apoB-48 , while mouse small intestine primarily expresses apoB-48

      • Cultured cells lack the complex microenvironment and cell-cell interactions of intact tissues

    • Consider whether differences reflect true biological complexity or experimental artifacts

  • Dosage and Compensation Analysis:

    • Evaluate differences in SURF4 depletion efficiency between models

    • Assess acute (siRNA) versus chronic (genetic knockout) depletion effects

    • Investigate compensatory mechanisms that may operate in vivo but not in vitro:

      • Altered expression of related cargo receptors

      • Systemic metabolic adaptations present only in whole organisms

  • Contextual Dependency Evaluation:

    • Identify context-specific factors that might influence SURF4 function:

      • Dietary status (fasting vs. fed state)

      • Circadian regulation

      • Hormonal influences present in vivo

    • Design experiments that recreate these contextual elements in vitro when possible

  • Translational Relevance Assessment:

    • Prioritize findings with consistent directionality across models

    • Develop scaled approaches that bridge the gap between systems:

      • Organoid cultures

      • Ex vivo tissue explants

      • Conditional knockout systems with temporal control

  • Mechanistic Reconciliation:

    • Focus on core mechanisms that are consistent across models

    • Develop unified models that explain apparent discrepancies

    • Design experiments specifically to test hypotheses that reconcile conflicting observations

By systematically addressing these considerations, researchers can develop more nuanced and accurate models of SURF4 function that incorporate insights from both in vitro simplicity and in vivo complexity.

What are the most promising therapeutic applications of targeting SURF4 for metabolic disorders?

Based on current research, the most promising therapeutic applications for targeting SURF4 in metabolic disorders include:

  • Atherosclerosis Treatment:

    • Previous studies have shown that silencing hepatic SURF4 markedly reduces atherosclerosis development in mouse models without causing hepatic steatosis

    • Potential therapeutic strategy focuses on tissue-specific SURF4 inhibition to reduce apoB-containing lipoproteins

    • Challenge: developing tissue-selective inhibitors that target hepatic SURF4 while sparing intestinal function

  • Dyslipidemia Management:

    • SURF4 inhibition reduces both VLDL and chylomicron secretion, potentially addressing both fasting and postprandial dyslipidemia

    • Could provide complementary approach to statins by targeting lipoprotein production rather than cholesterol synthesis

    • Consideration: effects may be more pronounced in postprandial states, requiring specific dosing strategies

  • Selective Cargo Pathway Modulation:

    • Different SURF4 cargoes use distinct SEC24 paralog interactions

    • Potential for developing inhibitors that selectively block specific cargo-SEC24 interactions

    • Could allow targeted inhibition of specific secretory pathways while preserving others

  • Intestinal-Specific Applications:

    • While complete intestinal SURF4 deficiency causes adverse effects , partial inhibition might provide metabolic benefits

    • Investigate dosage effects to identify therapeutic window between efficacy and side effects

    • Consider topical intestinal delivery to minimize systemic exposure

  • Combined Therapeutic Approaches:

    • Potential synergy with existing lipid-lowering therapies (statins, PCSK9 inhibitors)

    • Dual targeting of production (SURF4) and clearance (LDLR upregulation) pathways

    • Warrants investigation of potential drug-drug interactions

Research challenges include developing tissue-specific targeting strategies, as the search results indicate that intestinal SURF4 deficiency can cause intestinal damage and increased mortality, particularly in male mice . Therefore, any therapeutic approach must achieve a careful balance between efficacy and safety.

What technological advances are needed to better understand SURF4's structural interactions with diverse cargoes?

Advancing our understanding of SURF4's structural interactions with diverse cargoes requires several technological developments:

  • Cryo-EM Structures of SURF4-Cargo Complexes:

    • Current limitation: High-resolution structures of SURF4 with bound cargoes are lacking

    • Need for structures of SURF4 bound to various client proteins (apoB fragments, PCSK9, Cab45)

    • Challenge: Capturing transient interactions, especially for co-translational binding events

  • Advanced Binding Site Mapping Techniques:

    • Development of high-throughput approaches to map SURF4 binding sites across the proteome

    • Application of hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify interaction interfaces

    • Cross-linking mass spectrometry to capture transient cargo-receptor contacts

  • Real-time Visualization Technologies:

    • Super-resolution microscopy techniques to visualize SURF4-cargo interactions in living cells

    • Time-resolved imaging of cargo recruitment, binding, and export

    • Correlative light and electron microscopy to connect molecular interactions with ultrastructural context

  • Computational Prediction Tools:

    • Improved algorithms to predict ER-ESCAPE motifs across the proteome

    • Machine learning approaches to classify potential SURF4 clients based on sequence features

    • Molecular dynamics simulations of SURF4-cargo interactions in the ER membrane environment

  • In vitro Reconstitution Systems:

    • Development of membrane-based systems to reconstitute SURF4-mediated export

    • Cell-free translation systems coupled with ER-derived membranes to study co-translational binding

    • Synthetic biology approaches to recreate minimal SURF4-dependent export systems

  • Temporal Resolution Methods:

    • Techniques to distinguish co-translational from post-translational binding with precise timing

    • Pulse-chase approaches with improved temporal resolution

    • Optogenetic tools to trigger and monitor cargo-receptor interactions with millisecond precision

These technological advances would help resolve fundamental questions about how SURF4 recognizes and processes diverse cargo proteins and how these interactions are regulated in different cellular contexts.

How might researchers develop cell-type specific SURF4 targeting strategies to minimize adverse effects?

Development of cell-type specific SURF4 targeting strategies requires a multi-faceted approach to minimize adverse effects:

  • Tissue-Specific Delivery Systems:

    • Hepatocyte-targeted nanoparticles for liver-specific SURF4 inhibition

    • Explore receptors uniquely expressed on target cells for directed delivery

    • Design delivery vehicles that exploit tissue-specific characteristics (e.g., fenestrated endothelium in liver)

  • Conditional Genetic Approaches:

    • Refine tissue-specific Cre-loxP systems with improved specificity

    • Develop inducible systems with better temporal control to avoid developmental effects

    • Consider partial knockdown approaches rather than complete knockout to maintain essential functions

  • Paralog-Specific Targeting:

    • Investigate whether SEC24 paralog usage differences can be exploited:

      • Target SEC24A-SURF4 interactions to affect PCSK9 secretion

      • Spare SEC24C/D-dependent pathways to maintain essential secretory functions

    • Develop compounds that selectively disrupt specific SURF4-SEC24 paralog interactions

  • Cargo-Selective Inhibition:

    • Design inhibitors that block SURF4 binding to specific cargoes without affecting others

    • Target the lumenal binding pocket with structure-guided compounds that compete with specific ER-ESCAPE motifs

    • Exploit differences in co-translational versus post-translational binding mechanisms

  • Contextual Targeting:

    • Develop strategies that preferentially act under specific metabolic conditions

      • Diet-responsive inhibitors that act primarily in postprandial states

      • Compounds activated by hyperlipidemic conditions

    • Design time-released formulations that align with circadian patterns of lipoprotein secretion

  • Combination Approaches with Reduced Dosing:

    • Use partial SURF4 inhibition in combination with other therapeutic modalities

    • Identify synergistic targets that allow for lower SURF4 inhibition doses

    • Develop titration protocols to determine optimal inhibition levels for individual patients

These strategies aim to achieve therapeutic benefits while minimizing the adverse effects observed with complete SURF4 deficiency in the intestine, which include impaired nutrition, reduced body weight, and increased mortality .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.