Recombinant Human Synaptogyrin-3 (SYNGR3)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant SYNGR3 is produced using multiple expression systems, each with distinct advantages:

Host SystemPurityApplicationsReferences
E. coli≥85%Antibody production, ELISA, affinity assays
Yeast≥85%Structural studies, protein interactions
Baculovirus (insect)>90%Post-translational modification studies
Mammalian Cells>90%Functional assays mimicking native conditions

For example, the full-length SYNGR3 cDNA is cloned into vectors like pcDNA3.1(+) or pAAV using restriction enzymes (BamHI/XhoI) and transfected into SH-SY5Y neuronal cells for functional studies .

Dopamine Transporter (DAT) Regulation

  • SYNGR3 directly interacts with DAT to enhance dopamine reuptake in presynaptic terminals .

  • Overexpression in SH-SY5Y cells increased cellular dopamine uptake by 40% without altering DAT protein levels .

  • In LRRK2 mutant mice (Parkinson’s model), SYNGR3 overexpression restored striatal dopamine uptake and improved marble-burying behavior .

Synaptic Vesicle Dynamics

  • Binds Tau protein in pathogenic conditions, reducing vesicle mobility and neurotransmitter release .

  • Knockdown rescues Tau-induced synaptic dysfunction in hippocampal neurons .

Key Research Applications

ApplicationFindingsReferences
Parkinson’s disease modelsAAV7-mediated SYNGR3 delivery improved dopamine homeostasis in LRRK2 mice
Protein interaction studiesCo-immunoprecipitation confirmed SYNGR3-DAT and SYNGR3-Tau interactions
Transcriptional regulationNURR1 activator C-DIM12 upregulated SYNGR3 expression in neuronal cells
Behavioral assaysInnate behavior improvement in mutant mice post-SYNGR3 overexpression

In Vitro Studies

  • Transient SYNGR3 overexpression in SH-SY5Y cells increased DAT-mediated dopamine uptake by 1.5-fold .

  • C-DIM12 (NURR1 activator) elevated SYNGR3 protein levels by 2.2-fold in neuronal cells .

In Vivo Studies

ModelInterventionOutcome
LRRK2 R1441G mutant miceAAV7-SYNGR3 striatal injection35% increase in synaptosomal dopamine uptake
TauP301S transgenic miceSyngr3 knockdownRestored synaptic vesicle mobility and release

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SYNGR3; Synaptogyrin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SYNGR3
Target Protein Sequence
MEGASFGAGRAGAALDPVSFARRPQTLLRVASWVFSIAVFGPIVNEGYVNTDSGPELRCV FNGNAGACRFGVALGLGAFLACAAFLLLDVRFQQISSVRDRRRAVLLDLGFSGLWSFLWF VGFCFLTNQWQRTAPGPATTQAGDAARAAIAFSFFSILSWVALTVKALQRFRLGTDMSLF ATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVPAY
Uniprot No.

Target Background

Function
Synaptogyrin-3 may play a role in regulated exocytosis. It potentially regulates the activity of the plasma membrane dopamine transporter SLC6A3, indirectly influencing dopamine transport back from the synaptic cleft to the presynaptic terminal.
Gene References Into Functions
  1. This study identifies the mouse homolog, synaptogyrin 3, as a synaptic vesicle protein. PMID: 14755516
  2. This study demonstrates the interaction of the mouse homolog, synaptogyrin 3, with the dopamine transporter (DAT). PMID: 19357284
Database Links

HGNC: 11501

OMIM: 603927

KEGG: hsa:9143

STRING: 9606.ENSP00000248121

UniGene: Hs.435277

Protein Families
Synaptogyrin family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse.
Tissue Specificity
Expressed in brain and placenta.

Q&A

What is Synaptogyrin-3 and what is its primary cellular localization?

Synaptogyrin-3 (SYNGR3) is a synaptic vesicle protein primarily localized in presynaptic terminals . It belongs to the synaptogyrin family, distinct from but related to synaptogyrin-1, which is also neuronally expressed . Immunohistochemical studies show that SYNGR3 is particularly enriched in the stratum lucidum of the hippocampus, which contains synaptic contacts from dentate gyrus granule cells to CA3 pyramidal neurons via mossy fibers .

SYNGR3 shows differential distribution compared to synaptogyrin-1, with stronger expression in mossy fiber-CA3 synapses that are critical for working memory function . The protein can be detected using antibodies targeting either the C- or N-terminal domains, with the latter being sufficient for many of its protein interactions .

In dopaminergic neurons, SYNGR3 is found on synaptic vesicles and colocalizes with the dopamine transporter (DAT) at presynaptic terminals in the striatum . This specific localization pattern is functionally significant as it physically links dopamine reuptake mechanisms with vesicular storage systems.

What protein interactions does SYNGR3 form in neuronal systems?

SYNGR3 forms several critical protein interactions that appear to create functional complexes within presynaptic terminals:

  • Dopamine Transporter (DAT): SYNGR3 directly interacts with DAT, as confirmed through multiple methods including the split-ubiquitin system, coimmunoprecipitation experiments in both heterologous cells and mouse brain tissue, and fluorescence resonance energy transfer (FRET) microscopy in live neurons . The interaction occurs specifically through the cytoplasmic N-termini of both proteins .

  • Vesicular Monoamine Transporter-2 (VMAT2): Evidence suggests that SYNGR3 forms a biochemical complex involving both DAT and VMAT2, potentially creating a physical link between dopamine reuptake and vesicular storage mechanisms .

  • Tau Protein: Under pathogenic conditions, SYNGR3 serves as a receptor for Tau at presynaptic terminals . This interaction appears particularly relevant in disease states, as Alzheimer's disease patient brains show over 33-fold more Synaptogyrin-3-positive puncta that are also positive for Synapsin-1 and Tau compared to healthy controls .

These interactions collectively suggest that SYNGR3 functions as an organizational hub, coordinating dopamine uptake, vesicular packaging, and cytoskeletal dynamics in presynaptic terminals.

How can researchers effectively detect and quantify SYNGR3 expression?

Researchers can employ several complementary techniques to detect and quantify SYNGR3 expression:

Immunodetection Methods:

  • Western Blotting: Using antibodies that recognize either the C- or N-terminal domains of SYNGR3. Protein quantification can be performed relative to housekeeping proteins, with expression levels in heterozygous knockout models showing approximately 50% reduction compared to wild-type .

  • Immunohistochemistry/Immunofluorescence: For spatial localization within brain tissue, particularly effective for revealing enrichment patterns such as in the stratum lucidum .

  • Array Tomography: Used for high-resolution analysis of SYNGR3 colocalization with other synaptic proteins in postmortem human tissue .

Molecular Techniques:

  • RT-PCR/qPCR: For quantification of SYNGR3 mRNA levels.

  • siRNA Knockdown Validation: Using target sequences such as 5′-TCAGTGGCAACGTACAGCA-3′ (corresponding to nucleotides 570–588 of rat synaptogyrin-3) to confirm specificity of detection methods .

Genetic Models:

  • CRISPR-Cas9 Generated Models: Knockout and knockdown models targeting specific exons (e.g., the second exon) have been validated for SYNGR3 research .

For colocalization studies, dual labeling with established markers like Synaptoporin, Synapsin-1/3, or DAT provides context for SYNGR3's synaptic localization .

How does SYNGR3 influence dopamine neurotransmission and synaptic function?

SYNGR3 appears to play a multifaceted role in regulating dopamine neurotransmission through several mechanisms:

Enhancement of Dopamine Release and Signaling:

  • Overexpression of SYNGR3 in dopamine neurons leads to elevated basal extracellular dopamine levels in the nucleus accumbens, as demonstrated by microdialysis studies .

  • Fast scan cyclic voltammetry (FSCV) reveals that SYNGR3 overexpression augments dopamine release in response to electrical stimulation and increases calcium sensitivity .

Vesicular Dynamics Regulation:

  • SYNGR3 likely increases the efficiency of dopamine neurotransmission by fine-tuning readily releasable pool dynamics .

  • The protein facilitates vesicular release and enhances recycling of released dopamine .

DAT-VMAT2 Coupling:

  • SYNGR3 forms a complex with both DAT and VMAT2, creating a physical and functional link between dopamine reuptake and vesicular storage .

  • This interaction may optimize the transfer of reuptaken dopamine into vesicles for subsequent release.

Synaptic Plasticity Effects:

  • In the context of Tau pathology, normal SYNGR3 levels are associated with Tau-induced defects in long-term potentiation (LTP) at mossy fiber-CA3 synapses, while reduction of SYNGR3 corrects these defects .

Research suggests that SYNGR3 serves as a three-pronged regulator in presynaptic terminals: (1) as an exocytotic vesicle protein, (2) as a DAT-associated protein, and (3) as a tau-mediated regulator of vesicle trafficking . This multifunctional role positions SYNGR3 as a key coordinator of dopamine terminal function.

What is the relationship between SYNGR3 and neurological disorders?

SYNGR3 has been implicated in several neurological conditions through distinct mechanisms:

Alzheimer's Disease and Tauopathies:

  • In Alzheimer's disease patient brains, there is a 33-fold increase in synaptic terminals where SYNGR3 colocalizes with Tau compared to healthy controls .

  • SYNGR3 serves as a receptor for pathogenic Tau at presynaptic terminals, particularly in mossy fiber-CA3 synapses .

  • Heterozygous knockout of SYNGR3 in pathogenic Tau-expressing mice rescues Tau-induced long-term plasticity defects, synaptic loss, and working memory deficits, despite not affecting neuroinflammation .

  • This suggests that SYNGR3 mediates Tau-induced synaptic dysfunction independently from Tau-induced neuroinflammation .

Addiction and Substance Use Disorders:

  • SYNGR3 is reduced by chronic cocaine exposure in both humans and rats .

  • SYNGR3 levels are inversely correlated with motivation to take cocaine in rats .

  • Overexpression of SYNGR3 in dopamine neurons reduces cocaine self-administration, decreases anxiety-like behavior, and enhances cognitive flexibility .

  • SYNGR3 overexpression prevents cocaine-induced deficits in dopamine signaling .

These findings suggest that SYNGR3 could be a therapeutic target for both neurodegenerative disorders and addiction, with its modulation potentially offering disease-modifying effects through distinct but related synaptic mechanisms.

How does genetic manipulation of SYNGR3 affect behavioral and cognitive outcomes?

Genetic manipulation of SYNGR3 has revealed significant effects on behavioral and cognitive outcomes in animal models:

Effects of SYNGR3 Knockdown/Knockout:

  • Heterozygous SYNGR3 knockout mice (SYNGR3+/-) show no overt phenotype under normal conditions but exhibit protection against Tau-induced pathology .

  • When crossed with Tau P301S mice (a model of tauopathy), SYNGR3+/- animals show preserved working memory function compared to Tau P301S mice with normal SYNGR3 levels .

  • SYNGR3+/- mice crossed with Tau P301S models demonstrate more efficient adaptation to novel spatial locations in memory tasks, with significant reductions in path length and latency to find platforms in water maze tests .

Effects of SYNGR3 Overexpression:

  • SYNGR3 overexpression in dopamine neurons reduces cocaine self-administration in rats .

  • Rats overexpressing SYNGR3 complete reversal learning tasks more quickly than controls, exhibiting reduced perseveration of responding to original cues, indicating greater cognitive flexibility .

  • This enhanced cognitive flexibility appears to contribute to resilience against addiction-like behaviors .

  • Interestingly, SYNGR3 overexpression selectively inhibits cocaine-related behaviors without affecting preference for natural rewards like sucrose .

SYNGR3 ManipulationBehavioral/Cognitive Effects
Heterozygous knockout (SYNGR3+/-)- No effect on baseline function
- Protection against Tau-induced working memory deficits
- Rescue of long-term plasticity in Tau models
Overexpression in dopamine neurons- Reduced cocaine self-administration
- Enhanced cognitive flexibility
- Improved reversal learning
- Decreased anxiety-like behavior
- Normal natural reward processing

These findings suggest that strategic modulation of SYNGR3 levels could have therapeutic potential for both cognitive deficits in neurodegenerative disorders and maladaptive behaviors in addiction.

What techniques are commonly used to study SYNGR3 protein interactions?

Researchers employ multiple complementary techniques to characterize SYNGR3 protein interactions:

In vitro and Biochemical Approaches:

  • Split Ubiquitin System: Originally used to identify the interaction between SYNGR3 and DAT .

  • Coimmunoprecipitation (Co-IP): Validated in both heterologous cell lines and mouse brain tissue to confirm protein-protein interactions .

  • GST Pull-Down Assays: Using glutathione S-transferase fusion proteins to demonstrate that the cytoplasmic N-termini of both DAT and SYNGR3 are sufficient for their interaction .

  • Synaptic Vesicle Binding Assays: Showing that the N-terminus of DAT is capable of binding purified synaptic vesicles from brain tissue .

Imaging-Based Methods:

  • Immunofluorescence Colocalization: Using confocal microscopy to demonstrate spatial overlap of SYNGR3 with other proteins at presynaptic terminals .

  • Fluorescence Resonance Energy Transfer (FRET) Microscopy: Demonstrating protein interactions in live neurons .

  • Array Tomography: High-resolution analysis of protein colocalization in postmortem human brain tissue .

Functional Interaction Assessment:

  • Transporter Activity Assays: Measuring DAT activity in cells with varying levels of SYNGR3 expression .

  • Pharmacological Manipulation: Using drugs like reserpine (a VMAT2 inhibitor) to probe the functional dependence of protein interactions on vesicular dopamine storage .

For studying SYNGR3-tau interactions specifically, researchers have employed:

  • Isolation of Specific Synapses: Such as mossy fiber-CA3 synaptosomes, to verify protein colocalization in specific brain regions .

  • High-resolution immunolabeling: Using antibodies against SYNGR3, Synapsin-1, and Tau to visualize triple colocalization .

These techniques collectively provide complementary evidence for physical and functional interactions, enabling researchers to build a comprehensive understanding of SYNGR3's protein interaction network.

What genetic models and tools are available for SYNGR3 research?

Several genetic models and molecular tools have been developed for investigating SYNGR3 function:

Knockout and Knockdown Models:

  • Complete Knockout (SYNGR3-/-): Generated using CRISPR-Cas9 technology targeting the second exon of the endogenous gene . These mice are viable and fertile, born in expected Mendelian ratios, and show complete absence of SYNGR3 protein in brain homogenates .

  • Heterozygous Knockout (SYNGR3+/-): Express approximately 50% of normal SYNGR3 protein levels and show no significant changes in other synaptic proteins, including synaptogyrin-1 .

  • siRNA Knockdown: Stable cell lines expressing siRNA targeting SYNGR3 (target sequence: 5′-TCAGTGGCAACGTACAGCA-3′) have been generated in PC12 cells .

Overexpression Systems:

  • Viral-mediated Overexpression: AAV vectors delivering SYNGR3 specifically to dopamine neurons have been used to study effects on addiction-related behaviors and dopamine signaling .

  • Heterologous Expression Systems: Including transfected HEK-293, PC12, and MN9D cells for studying SYNGR3 effects on DAT function .

Disease Models with SYNGR3 Manipulation:

  • Tau P301S × SYNGR3+/-: Crossing Tau P301S mice (PS19 line, a model of tauopathy) with SYNGR3+/- mice to study the effects of reduced SYNGR3 on Tau-induced pathology .

  • Cocaine Self-administration with SYNGR3 Overexpression: To study SYNGR3's role in addiction vulnerability and resilience .

Antibodies and Detection Tools:

  • Domain-specific Antibodies: Recognizing either C- or N-terminal domains of SYNGR3 .

  • Fluorescently Tagged Constructs: For live imaging and FRET studies of protein interactions .

These genetic tools provide researchers with capabilities to manipulate SYNGR3 levels in various cellular and in vivo contexts, enabling detailed investigation of its physiological and pathological roles.

What are the optimal protocols for producing recombinant human SYNGR3?

While the search results don't provide specific protocols for recombinant SYNGR3 production, standard approaches for membrane protein expression can be adapted based on the information available:

Expression System Considerations:

  • Bacterial Expression: May be suitable for cytoplasmic domains (such as the N-terminus) that mediate key protein interactions .

  • Mammalian Expression Systems: Preferable for full-length protein production, particularly when post-translational modifications and proper membrane topology are important.

  • Insect Cell Systems: Offer a compromise between bacterial and mammalian systems for membrane protein production.

Key Domains for Expression:

  • The N-terminus of SYNGR3 is particularly important as it mediates interactions with DAT and potentially other proteins . Expressing this domain as a GST-fusion protein has proven successful for interaction studies .

Purification Approaches:

  • Affinity tags such as His-tags or GST fusions facilitate purification while potentially preserving protein function.

  • For membrane proteins like SYNGR3, detergent selection is critical for maintaining native structure.

Functional Validation:

  • Recombinant SYNGR3 should be validated for proper folding and function through:

    • Binding assays with known interaction partners (DAT, VMAT2)

    • Vesicle incorporation assays to confirm membrane association

    • Functional complementation in SYNGR3-deficient cellular models

Storage Considerations:

  • As a membrane protein, SYNGR3 stability may be enhanced by storage in glycerol-containing buffers or by maintaining association with lipid membranes.

For cytoplasmic domain expression, the demonstrated success of GST-fusion proteins for the N-terminus suggests this approach is viable for producing domains suitable for interaction studies . Complete protocols would need to address optimal detergent selection, lipid composition for reconstitution, and verification of proper membrane topology for full-length protein.

How does SYNGR3 contribute to the pathophysiology of Tau-related disorders?

SYNGR3 appears to play a mechanistic role in Tau-mediated neurodegeneration through several interconnected pathways:

Presynaptic Tau Receptor Function:

  • SYNGR3 serves as a receptor for pathogenic Tau at presynaptic terminals, particularly in mossy fiber-CA3 synapses that are critical for working memory .

  • In Alzheimer's disease patient brains, there is a 33-fold increase in synaptic puncta showing colocalization of SYNGR3, Synapsin-1, and Tau compared to healthy controls .

  • This suggests SYNGR3 may facilitate the accumulation or toxic effects of Tau at synapses.

Synaptic Pathology Mediation:

  • Tau P301S mice show reduced expression of synaptic markers in the stratum lucidum, including both pre-synaptic (Synaptoporin, Synapsin-3) and post-synaptic (GluK5, Nectin-3) proteins .

  • Genetic reduction of SYNGR3 in Tau P301S mice rescues these synaptic deficits, restoring normal levels of these markers .

  • This indicates SYNGR3 is required for Tau-induced synaptic degeneration.

Dissociation from Neuroinflammation:

  • While SYNGR3 reduction rescues synaptic defects and cognitive impairment in Tau models, it does not affect Tau-induced neuroinflammation .

  • This suggests parallel pathogenic mechanisms, with SYNGR3 specifically mediating synaptic rather than inflammatory aspects of Tau pathology.

Functional Consequence:

  • Tau P301S mice exhibit impaired long-term potentiation (LTP) at mossy fiber-CA3 synapses, which is rescued by SYNGR3 reduction .

  • Working memory deficits in Tau P301S mice are similarly corrected by SYNGR3 reduction .

These findings reveal SYNGR3 as a critical mediator of Tau-induced synaptic dysfunction and cognitive impairment, potentially acting as a link between pathogenic Tau accumulation and functional deficits in Alzheimer's disease and other tauopathies.

What evidence supports SYNGR3 as a potential therapeutic target for addiction disorders?

Multiple lines of evidence suggest SYNGR3 may be a promising therapeutic target for addiction disorders:

Dysregulation in Addiction:

  • SYNGR3 levels are reduced by chronic cocaine exposure in both humans and rats .

  • SYNGR3 expression is inversely correlated with motivation to take cocaine in rats, suggesting a protective role .

Behavioral Effects of SYNGR3 Overexpression:

  • Rats with SYNGR3 overexpression in dopamine neurons show:

    • Reduced cocaine self-administration

    • Decreased anxiety-like behavior

    • Enhanced cognitive flexibility with improved reversal learning

    • More rapid adaptation to changing reward contingencies

Selective Effect on Drug vs. Natural Rewards:

  • SYNGR3 overexpression does not affect preference for or responding to sucrose, a natural reward .

  • This selective effect on drug-related behaviors is a desirable profile for addiction therapeutics .

Neurochemical Mechanisms:

  • SYNGR3 overexpression enhances nucleus accumbens dopamine signaling .

  • It prevents cocaine-induced deficits in dopamine neurotransmission .

  • SYNGR3 appears to increase the efficiency of dopamine neurotransmission by optimizing vesicle dynamics and dopamine recycling .

Molecular Integration:

  • SYNGR3's unique position as a link between dopamine transporter function, vesicular storage, and release mechanisms makes it a potential master regulator of dopamine terminal function .

These findings suggest that therapeutic approaches aimed at increasing SYNGR3 expression or function specifically in dopamine neurons could provide a novel strategy for treating cocaine use disorder and potentially other forms of addiction. The enhancement of cognitive flexibility is particularly noteworthy, as reduced cognitive flexibility is associated with habitual or compulsive responding that can perpetuate drug use behaviors .

What methodological challenges exist in translating SYNGR3 research to therapeutic applications?

Several methodological challenges need to be addressed in translating SYNGR3 research to therapeutic applications:

Target Accessibility and Specificity:

  • As an intracellular membrane protein, SYNGR3 presents challenges for drug targeting compared to cell-surface receptors.

  • Achieving selective targeting of SYNGR3 in specific neuronal populations (e.g., dopamine neurons for addiction, or specific hippocampal circuits for Alzheimer's) requires sophisticated delivery approaches.

Functional Complexity:

  • SYNGR3 has multiple interaction partners and functions, including roles with DAT, VMAT2, and Tau .

  • Therapeutic modulation needs to selectively affect pathological interactions while preserving physiological functions.

Bidirectional Effects in Different Disorders:

  • SYNGR3 reduction is beneficial in Tau-related pathology .

  • SYNGR3 overexpression is beneficial in addiction models .

  • This suggests disorder-specific targeting strategies are needed rather than general SYNGR3 modulators.

Delivery Challenges:

  • For genetic approaches (e.g., viral vector delivery of SYNGR3), achieving sufficient brain penetration and cell-type specificity remains challenging.

  • For small molecule approaches, identifying compounds that modulate SYNGR3 function or its specific protein interactions requires development of appropriate screening assays.

Translational Gaps:

  • While animal models show promising results, human SYNGR3 biology may differ in important ways.

  • The interface between SYNGR3, dopamine systems, and complex human behaviors like addiction requires further characterization.

Biomarker Development:

  • Establishing accessible biomarkers to monitor SYNGR3 function or its therapeutic modulation in humans is needed for clinical development.

Addressing these challenges will require multidisciplinary approaches, including:

  • Development of cell-type specific delivery systems

  • Identification of specific binding sites mediating pathological vs. physiological interactions

  • Creation of screening platforms for small molecules that modulate specific SYNGR3 functions

  • Validation in human-derived systems (e.g., iPSC neurons) before clinical translation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.