Recombinant Human Synaptogyrin-4 (SYNGR4)

Shipped with Ice Packs
In Stock

Description

Introduction to Synaptogyrin-4

Synaptogyrin-4 (SYNGR4) belongs to the synaptogyrin family of conserved integral membrane proteins associated with cellular vesicles. SYNGR4 is notably the least characterized member among the four synaptogyrins identified to date . The human SYNGR4 gene encodes a protein that shares structural similarities with other family members while likely serving distinct cellular functions. The recombinant form of this protein has become increasingly important for research applications aimed at elucidating its biological role and potential implications in disease states.

Synaptogyrins as a family are characterized by their multiple membrane-spanning domains, with highest conservation observed in these transmembrane regions. They typically feature connecting intra- and extracellular loops along with short cytoplasmic N- and C-terminal tails . While structurally similar, individual synaptogyrins associate with different cellular membrane populations and appear to serve diverse functions in cellular trafficking and communication mechanisms.

The human SYNGR4 protein is identified in protein databases with the UniProt ID O95473, and its recombinant form has become an essential tool for researchers investigating vesicular trafficking and neurodegenerative conditions .

Comparison with Other Synaptogyrin Family Members

Unlike its better-characterized family members SYNGR1 and SYNGR3 (which are predominantly expressed in the nervous system and associate with classical small synaptic vesicles), SYNGR4 appears to have distinct tissue distribution and vesicular associations . While SYNGR1 and SYNGR3 apparently function as negative regulators of neurotransmission, the specific role of SYNGR4 remains less defined.

Another family member, SYNGR2 (also known as cellugyrin), has been extensively studied for its role in trafficking glucose transporter GLUT4-containing vesicles, which is crucial for glucose homeostasis in various tissues. Research has shown that SYNGR2/cellugyrin marks a significant subpopulation of GLUT4 vesicles that is not recruited to the plasma membrane in response to insulin signaling . By comparison, the specific vesicular populations associated with SYNGR4 and their response to cellular signaling remain to be fully characterized.

Expression Systems and Methods

Recombinant Human SYNGR4 protein is typically expressed in prokaryotic systems, with Escherichia coli being the predominant expression host . The full-length human protein (spanning amino acids 1-234) is commonly produced with an N-terminal histidine tag to facilitate purification through affinity chromatography. This approach allows for efficient isolation of the protein from bacterial lysates.

The recombinant production process generally involves:

  1. Cloning the human SYNGR4 gene into an appropriate expression vector

  2. Transforming E. coli cells with the construct

  3. Inducing protein expression under controlled conditions

  4. Cell lysis and protein extraction

  5. Purification using affinity chromatography

  6. Quality control testing including purity assessment by SDS-PAGE

Reconstitution Protocol

The recommended reconstitution procedure for lyophilized SYNGR4 protein involves:

  1. Brief centrifugation of the vial prior to opening to bring contents to the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol to a final concentration of 5-50% (typically 50%) for long-term storage

  4. Aliquoting the reconstituted protein to minimize freeze-thaw cycles

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during the lyophilization process and subsequent reconstitution .

Cellular Localization and Membrane Association

As a member of the synaptogyrin family, SYNGR4 is an integral membrane protein associated with cellular vesicles . While the specific vesicular populations that SYNGR4 associates with are not fully characterized, structural similarities with other family members suggest potential roles in vesicle trafficking and membrane dynamics.

Potential Functional Roles

Current understanding of SYNGR4 function is largely based on comparative analysis with better-characterized synaptogyrin family members. While SYNGR1 and SYNGR3 function in neurotransmission and SYNGR2/cellugyrin plays a role in glucose transporter trafficking, the specific cellular processes regulated by SYNGR4 remain to be fully elucidated .

Research suggests that SYNGR4 may play a role in cellular vesicle trafficking, possibly mediating protein transport between sorting endosomes and other cellular compartments . The four membrane-spanning domains characteristic of synaptogyrins likely facilitate integration into vesicular membranes, positioning SYNGR4 to influence vesicle formation, trafficking, or fusion events.

Neurodegenerative Disease Associations

Recent research has identified altered SYNGR4 levels in motor neurons as potentially significant in neurodegenerative conditions. Studies of mouse models of ALS (Amyotrophic Lateral Sclerosis) have revealed that SYNGR4 is among proteins whose levels are altered within motor neurons coincident with the transition to overt motor symptoms .

Research using RNA-seq analysis and quantitative immunostaining of spinal cord tissue has demonstrated protein-level changes in SYNGR4 within motor neurons. These alterations were observed in independent mouse models based on TDP-43 mutations, suggesting a potential role for SYNGR4 deregulation in motor neuron degeneration pathways .

Hypothesized Mechanisms in Neurodegeneration

While the exact mechanism by which altered SYNGR4 levels might contribute to motor neuron degeneration remains unclear, researchers have proposed several hypotheses. One working model features altered trafficking of specific vesicles, with possible roles for phosphatidylserine (PS) and unconventional myosins, and potential effects on cell-surface levels of specific receptors implicated in insulin signaling and neurodegeneration .

Given that other synaptogyrin family members are involved in vesicular trafficking related to neurotransmission (SYNGR1, SYNGR3) and glucose homeostasis (SYNGR2), altered SYNGR4 function might disrupt critical vesicular transport processes required for motor neuron survival and function.

Current Research Utilization

Recombinant SYNGR4 protein serves as an important tool for multiple research applications, including:

  1. Generation and validation of antibodies for immunodetection of endogenous SYNGR4

  2. Protein interaction studies to identify binding partners

  3. Structural analyses to elucidate functional domains

  4. Development of assays for screening potential modulators

  5. Investigation of post-translational modifications

The availability of purified recombinant protein enables quantitative analysis of SYNGR4 levels in various experimental systems and facilitates the development of detection methods for studying its expression patterns across tissues and disease states.

Limitations in Current Understanding

Despite the availability of recombinant SYNGR4 for research purposes, significant knowledge gaps persist regarding this protein's function. Researchers note that SYNGR4 remains "the least characterized of the four-member synaptogyrin family" , highlighting the need for continued investigation into its biological roles and disease associations.

The limited understanding of SYNGR4 contrasts with the more extensive characterization of other synaptogyrin family members, presenting both challenges and opportunities for researchers seeking to elucidate its specific functions in normal physiology and disease contexts.

Addressing Knowledge Gaps

Several critical areas require further investigation to better understand SYNGR4 biology:

  1. Comprehensive characterization of SYNGR4 tissue distribution and subcellular localization

  2. Identification of specific vesicular populations associated with SYNGR4

  3. Elucidation of protein interaction networks and binding partners

  4. Investigation of post-translational modifications affecting SYNGR4 function

  5. Development of knockout and overexpression models to assess functional consequences

  6. Detailed analysis of SYNGR4 alterations in various disease contexts

Therapeutic Potential

Understanding SYNGR4's role in neurodegenerative conditions could potentially reveal new therapeutic targets. If altered SYNGR4 levels contribute to motor neuron degeneration, as suggested by studies in ALS models, interventions aimed at normalizing its expression or function might offer novel approaches for treating these conditions .

The emerging association between SYNGR4 and motor neuron health highlights the importance of continued research into this relatively understudied protein and its potential implications for neurological disease treatment strategies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it according to your requirement.
Synonyms
SYNGR4; Synaptogyrin-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SYNGR4
Target Protein Sequence
MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKMESPQLHCILN SNSVACSFAVGAGFLAFLSCLAFLVLDTQETRIAGTRFKTAFQLLDFILAVLWAVVWFMG FCFLANQWQHSPPKEFLLGSSSAQAAIAFTFFSILVWIFQAYLAFQDLRNDAPVPYKRFL DEGGMVLTTLPLPSANSPVNMPTTGPNSLSYASSALSPCLTAPKSPRLAMMPDN
Uniprot No.

Target Background

Database Links

HGNC: 11502

OMIM: 608373

KEGG: hsa:23546

UniGene: Hs.408333

Protein Families
Synaptogyrin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the cellular localization of SYNGR4 in neuronal cells?

SYNGR4 (Synaptogyrin-4) primarily localizes to specific vesicular structures within neuronal cells, showing a distinct distribution pattern compared to other synaptic proteins. Unlike synaptogyrin-1 which is predominantly found at synaptic vesicles, SYNGR4 appears to be associated with intracellular vesicles engaged in retrograde transport between endosomal compartments and the Trans-Golgi network (TGN) . This localization pattern suggests SYNGR4 may function in storage and/or retrograde transport of specific cellular cargo proteins.

For researchers investigating SYNGR4 localization, immunofluorescence studies should employ careful controls including SYNGR4-knockout neurons to validate antibody specificity. Co-localization experiments should include markers for different cellular compartments, particularly endosomal structures and the TGN. When designing expression constructs, researchers can use fluorescent protein tags such as mCherry-SYNGR4, similar to approaches used for other synaptic proteins like mCherry-syt-IV, which has been effectively used to study vesicular trafficking . High-resolution confocal or super-resolution microscopy is recommended for precise subcellular localization analysis, as conventional microscopy may not resolve the distinct vesicular populations containing SYNGR4.

How does SYNGR4 differ functionally from other synaptogyrin family members?

The synaptogyrin family includes four members (SYNGR1-4), but SYNGR4 displays several distinctive functional characteristics that distinguish it from its relatives. While all synaptogyrins share a similar four-transmembrane domain structure, their subcellular localization and proposed functions differ substantially. SYNGR2 (also known as cellugyrin) has been extensively characterized as marking a subpopulation of GLUT4-containing vesicles that mediate protein transport between sorting endosomes and the endocytic recycling compartment and/or trans-Golgi network .

SYNGR4, by contrast, does not colocalize with classical synaptic vesicle markers in motor neurons . Its functional role appears to be similar to SYNGR2 but in a different context - promoting internalization and retrograde trafficking of specific "SYNGR-4 vesicles" (S4Vs) between early endosomes and the TGN. This process effectively regulates the membrane expression of associated cargo proteins, potentially including the glucagon-like peptide-1 receptor (GLP-1R) . Unlike SYNGR1, which is widely expressed in neurons and concentrated at synaptic vesicles, SYNGR4 shows more restricted expression patterns and is notably upregulated in motor neurons in ALS models .

Methodologically, researchers can distinguish SYNGR4 function from other family members through comparative loss-of-function and gain-of-function studies, examining the trafficking of specific cargo proteins in response to manipulation of different synaptogyrin family members.

What are the recommended protocols for expressing recombinant human SYNGR4 in neuronal cultures?

For optimal expression of recombinant human SYNGR4 in neuronal cultures, researchers should consider several key methodological approaches based on techniques that have proven successful for similar synaptic proteins.

Lentiviral transduction represents the most effective delivery method for primary neurons. When designing lentiviral constructs, placing SYNGR4 under the control of the synapsin promoter ensures neuron-specific expression with physiologically relevant levels, similar to the approach used for synaptotagmin-IV and SNX4 studies . This avoids potential artifacts from excessive overexpression while maintaining sufficient protein levels for detection.

For construct design:

  • Include a fluorescent protein tag (GFP, mCherry) to facilitate visualization

  • Consider using a T2A or similar cleavage sequence if separate expression of the fluorescent marker is preferred

  • For co-expression studies with potential interaction partners like GLP-1R, employ dual promoter constructs or separate viral vectors with complementary fluorophores

The preparation of primary neuronal cultures for SYNGR4 expression should follow established protocols:

  • Isolate hippocampal or cortical neurons from P0-P1 mouse pups

  • Maintain in Neurobasal medium supplemented with B-27, GlutaMAX, and antibiotics

  • Culture on poly-ornithine/laminin-coated surfaces or on astrocyte feeder layers

  • Allow maturation for at least 14-21 days in vitro for optimal synaptic development

For viral transduction, infect neurons between DIV0-7 depending on the experimental timeline. Earlier infection typically yields higher expression but may interfere with normal development if the expressed protein disrupts critical developmental processes. When evaluating expression, use immunocytochemistry with MAP2 co-staining to identify neuronal processes and VAMP2/synaptobrevin2 to mark synaptic structures .

How can researchers effectively investigate the trafficking dynamics of SYNGR4-containing vesicles?

Investigating SYNGR4 trafficking dynamics requires sophisticated live imaging approaches combined with quantitative analysis. Based on methods successfully employed for other vesicular trafficking proteins, the following comprehensive experimental strategy is recommended:

For live imaging of SYNGR4-containing vesicles, researchers should express fluorescently-tagged SYNGR4 (e.g., GFP-SYNGR4) in primary neurons. Time-lapse confocal microscopy with acquisition rates of at least 2 Hz is necessary to capture rapid vesicular movements . To distinguish SYNGR4-specific trafficking from general endosomal movement, dual-color imaging with established compartment markers is essential. This approach has been successfully used for synaptotagmin-IV, where mCherry-syt-IV was co-expressed with BDNF-GFP to reveal co-trafficking dynamics .

To determine if SYNGR4-containing vesicles undergo exocytosis and endocytosis in response to neuronal activity, researchers can adapt the antibody uptake assay used for studying synaptotagmin-IV vesicles . In this approach, neurons expressing GFP-tagged SYNGR4 are depolarized in the presence of extracellular antibodies against GFP. If vesicles containing GFP-SYNGR4 fuse with the plasma membrane, their lumenal GFP tags become exposed to the extracellular environment, allowing antibody binding and marking sites of exocytosis.

For quantitative analysis of trafficking parameters, researchers should measure:

  • Vesicle velocity and directionality (anterograde vs. retrograde)

  • Frequency of pausing at specific cellular locations

  • Co-localization with endosomal markers during movement

  • Activity-dependence of trafficking (comparing basal vs. stimulated conditions)

To determine if SYNGR4 regulates exocytosis of specific cargo proteins, researchers can employ pH-sensitive fluorescent protein tags (pHluorin) fused to potential cargo proteins. This approach has been successfully used to measure synaptic vesicle exocytosis with synaptophysin-pHluorin . Comparing the exocytosis dynamics in wild-type, SYNGR4-overexpressing, and SYNGR4-knockout neurons would reveal SYNGR4's regulatory role in cargo trafficking.

What is the significance of the potential interaction between SYNGR4 and GLP-1R, and how can this interaction be validated experimentally?

The potential interaction between SYNGR4 and glucagon-like peptide-1 receptor (GLP-1R) identified through membrane-bound yeast two-hybrid screening has substantial implications for both neuronal function and metabolic regulation. GLP-1R functions as a key regulator of neuroprotective central nervous system insulin signaling, suggesting SYNGR4 may influence critical neuroprotective pathways by modulating GLP-1R trafficking and availability.

The functional significance of this interaction lies in SYNGR4's proposed role in retrograde vesicular trafficking. By analogy to SYNGR2/cellugyrin function, increased SYNGR4 expression could lead to enhanced intracellular retention of GLP-1R in SYNGR4-containing vesicles, reducing receptor availability at the cell surface . This would potentially attenuate GLP-1R-mediated neuroprotective signaling, with implications for neuronal health and survival, particularly in the context of neurodegenerative diseases where SYNGR4 is upregulated.

To experimentally validate and characterize this interaction, researchers should implement a multi-faceted approach:

  • Biochemical validation:

    • Co-immunoprecipitation experiments with both endogenous proteins and tagged constructs

    • Proximity ligation assays to detect interactions in situ

    • FRET or BiFC approaches to confirm direct interaction in living cells

  • Functional validation:

    • Surface biotinylation assays to measure GLP-1R plasma membrane levels in response to SYNGR4 manipulation

    • GLP-1R internalization and recycling kinetics in SYNGR4 knockout vs. overexpressing neurons

    • Downstream signaling assays (cAMP production, Akt phosphorylation) following GLP-1 stimulation

  • Interaction domain mapping:

    • Generate deletion mutants of both proteins to identify critical binding regions

    • Perform site-directed mutagenesis of key residues in identified interaction domains

    • Design competing peptides based on interaction domains to disrupt binding

This comprehensive experimental approach will establish both the physical interaction between SYNGR4 and GLP-1R and its functional consequences for GLP-1R trafficking and signaling, potentially revealing new therapeutic targets for conditions where this pathway is disrupted.

How does SYNGR4 upregulation contribute to the pathophysiology of motor neuron diseases such as ALS?

The upregulation of SYNGR4 in motor neurons coincident with symptom onset in ALS mouse models represents a significant finding that warrants detailed investigation . This temporal correlation suggests SYNGR4 may play a mechanistic role in disease pathophysiology, although current evidence cannot distinguish whether this upregulation represents a protective response, a contributor to pathology, or a secondary effect of disease processes.

Based on SYNGR4's proposed function in retrograde vesicular trafficking, several potential pathophysiological mechanisms can be postulated:

  • Altered receptor trafficking and signaling: Increased SYNGR4 could enhance intracellular retention of critical surface receptors like GLP-1R, potentially reducing neuroprotective insulin signaling in motor neurons . This disruption could contribute to neuronal vulnerability in ALS.

  • Disrupted protein homeostasis: SYNGR4 upregulation might represent a compensatory response to protein aggregation, potentially involved in clearing toxic proteins through enhanced retrograde trafficking. Alternatively, it could contribute to protein mislocalization by altering normal trafficking routes.

  • Synaptic dysfunction: While SYNGR4 does not colocalize with classical synaptic vesicle markers , its upregulation may indirectly affect synaptic transmission through interactions with other trafficking pathways, contributing to early synaptic dysfunction in ALS.

To experimentally determine SYNGR4's role in ALS pathophysiology, researchers should pursue:

  • Genetic manipulation studies in ALS models:

    • Cross SYNGR4 knockout mice with ALS model mice (TDP-43 mutants)

    • Use viral-mediated overexpression or knockdown of SYNGR4 in established ALS models

    • Assess effects on disease onset, progression, and survival

  • Cargo identification and trafficking analysis:

    • Identify specific cargo proteins of SYNGR4 vesicles in motor neurons

    • Determine if trafficking of these cargoes is altered in ALS models

    • Focus on receptors involved in neuronal survival pathways, including GLP-1R

  • Human tissue validation:

    • Examine SYNGR4 expression in post-mortem spinal cord tissue from ALS patients

    • Compare findings between familial and sporadic cases

    • Correlate expression levels with disease duration and progression rates

These approaches will help determine whether SYNGR4 represents a potential therapeutic target in ALS and whether strategies should aim to enhance or inhibit its function.

What are the optimal experimental systems for studying SYNGR4 function in vitro?

Selecting appropriate experimental systems is crucial for investigating SYNGR4 function in vitro. Based on approaches successfully employed for similar synaptic proteins, researchers should consider a complementary range of systems each offering distinct advantages:

Primary Neuronal Cultures:
Primary hippocampal or cortical neurons represent the gold standard for studying synaptic proteins in a physiologically relevant context. For SYNGR4 studies, neurons should be prepared from P0-P1 mouse pups following established protocols:

  • Dissect hippocampi in Hanks' balanced salt solution supplemented with 10 mM HEPES

  • Digest with 0.25% trypsin for 20 minutes at 37°C

  • Triturate with fire-polished glass pipettes after washing

  • Plate in Neurobasal medium supplemented with B-27, GlutaMAX, and antibiotics

  • Culture on poly-ornithine/laminin-coated surfaces or on astrocyte feeder layers

  • Allow maturation for 14-21 days in vitro for formation of functional synapses

For genetic manipulation, lentiviral transduction provides the most efficient approach for primary neurons. Constructs should be designed under neuron-specific promoters like synapsin, with fluorescent markers to identify transduced cells .

Motor Neuron Models:
Given SYNGR4's upregulation in motor neurons of ALS models , motor neuron cultures provide particular relevance:

  • Primary motor neurons isolated from spinal cord

  • iPSC-derived motor neurons from control and ALS patient samples

  • NSC-34 cells (motor neuron-like cell line) for high-throughput studies

Mixed Neuronal-Glial Cultures:
For studying SYNGR4 in a more complex cellular environment:

  • Prepare neurons on pre-grown glial cultures as described for EM studies

  • This system allows assessment of potential non-cell autonomous effects

Experimental Readouts:
Each system should be selected based on the specific aspect of SYNGR4 function being investigated:

Experimental QuestionOptimal SystemKey Readout Methods
Subcellular localizationPrimary neuronsImmunofluorescence, EM
Protein interactionsHEK293 cells, primary neuronsCo-IP, proximity ligation
Vesicle traffickingPrimary neurons, live imagingTime-lapse confocal microscopy
Receptor surface expressionPrimary neurons, cell linesSurface biotinylation, antibody feeding
Electrophysiological effectsPrimary neuronsPatch-clamp recording

For the most comprehensive understanding of SYNGR4 function, researchers should validate key findings across multiple experimental systems, leveraging the specific advantages of each approach.

How can researchers effectively detect and measure changes in SYNGR4 expression levels in experimental models?

Accurate quantification of SYNGR4 expression is fundamental to understanding its role in normal physiology and disease states. Based on methodologies established for similar synaptic proteins, researchers should implement a multi-modal approach to measure SYNGR4 expression with high sensitivity and specificity.

Protein-Level Detection:

  • Western Blotting:

    • Sample preparation: Use RIPA buffer supplemented with protease inhibitors for total protein extraction

    • Gel selection: 12-15% SDS-PAGE gels are optimal for resolving SYNGR4 (~26 kDa)

    • Controls: Include SYNGR4 knockout samples as negative controls to confirm antibody specificity

    • Quantification: Normalize to appropriate loading controls (β-actin, GAPDH, or preferably neuronal-specific markers like β-III tubulin for brain samples)

  • Immunofluorescence:

    • Fixation: 3.7% formaldehyde in PBS for 25 minutes at room temperature

    • Permeabilization: 0.5% Triton X-100 for 5 minutes followed by blocking with 2% normal goat serum

    • Antibody selection: Validate commercial antibodies against SYNGR4 knockout controls

    • Co-staining: Include neuronal markers (MAP2) and compartment-specific markers to assess distribution

    • Quantification: Measure fluorescence intensity using standardized imaging parameters and automated analysis software

mRNA-Level Detection:

  • RT-qPCR:

    • RNA extraction: Use RNeasy kits with on-column DNase digestion

    • Primer design: Target exon-exon junctions to avoid genomic DNA amplification

    • Reference genes: Validate stability of multiple reference genes (GAPDH, β-actin, HPRT) under experimental conditions

    • Analysis: Use the ΔΔCt method with efficiency correction

  • In situ hybridization:

    • RNAscope or similar sensitive methods for spatial resolution of SYNGR4 mRNA

    • Combine with immunofluorescence for cell-type identification

    • Quantify signal intensity in specific cell populations

High-Throughput Methods:

  • RNA-Seq:

    • Particularly valuable for whole-transcriptome context alongside SYNGR4

    • Consider cell-type specific approaches (FACS sorting, single-cell RNA-seq)

    • Validate key findings with RT-qPCR

  • Proteomics:

    • Use targeted approaches (selected reaction monitoring) for higher sensitivity

    • Include appropriate internal standards

    • Validate with orthogonal methods (Western blot)

Experimental Design Considerations:

For measuring SYNGR4 upregulation in disease models or following experimental manipulations:

  • Include time-course analyses to capture dynamic changes

  • Examine multiple brain regions/cell types to determine specificity

  • Compare expression across different disease models (e.g., different ALS mutations )

  • Include age-matched controls for each time point

  • Blind samples during analysis to prevent bias

This comprehensive approach to SYNGR4 expression analysis ensures robust quantification across different experimental paradigms and provides the foundation for functional studies.

What techniques can researchers use to identify and validate interaction partners of SYNGR4?

Identifying and validating the interaction partners of SYNGR4 is crucial for understanding its functional roles in vesicular trafficking and potential disease mechanisms. Building upon established approaches used for similar membrane proteins, researchers should implement a comprehensive workflow combining discovery-based and targeted validation methods.

Discovery-Based Approaches:

  • Immunoprecipitation coupled with mass spectrometry (IP-MS):

    • Express tagged SYNGR4 (FLAG, HA, or biotin acceptor peptide) in neuronal cells

    • Crosslink proteins if transient interactions are suspected

    • Use mild detergents (CHAPS, digitonin) to preserve membrane protein interactions

    • Perform IP followed by tryptic digestion and LC-MS/MS

    • Compare with appropriate controls (empty vector, unrelated membrane protein)

  • Proximity-based labeling:

    • Generate SYNGR4 fusion constructs with BioID or APEX2

    • Express in relevant neuronal models

    • Activate labeling (biotin addition for BioID, H₂O₂ for APEX2)

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach captures both stable and transient interactions in the native cellular environment

  • Membrane yeast two-hybrid screening:

    • Particularly suitable for membrane proteins like SYNGR4

    • Has successfully identified GLP-1R as a potential SYNGR4 interaction partner

    • Use neuronal or brain-derived cDNA libraries

Targeted Validation Methods:

  • Co-immunoprecipitation (Co-IP):

    • Validate key interactions identified in discovery approaches

    • Perform reciprocal Co-IPs (IP with anti-SYNGR4 and blot for partner, and vice versa)

    • Include negative controls (IgG, irrelevant membrane protein)

    • Test interactions under different conditions (basal, stimulated)

  • Proximity ligation assay (PLA):

    • Enables visualization of protein interactions in situ

    • Requires antibodies against both SYNGR4 and putative partners

    • Provides spatial information about where interactions occur within the cell

  • FRET/BRET approaches:

    • Generate fluorescent/luminescent fusion proteins

    • Measure energy transfer as indicator of protein proximity

    • Permits real-time analysis of dynamic interactions in living cells

  • Functional validation:

    • Knockout/knockdown of interaction partner and assess effect on SYNGR4 localization/function

    • Design competing peptides based on interaction domains

    • Generate point mutations in key residues and test interaction disruption

Application to GLP-1R Interaction:

The reported interaction between SYNGR4 and GLP-1R identified through membrane yeast two-hybrid approaches provides an excellent case study for validation. Researchers should:

  • Confirm physical interaction through Co-IP and PLA

  • Determine if SYNGR4 regulates GLP-1R surface expression through surface biotinylation assays

  • Assess if SYNGR4 affects GLP-1-induced signaling (cAMP production, calcium mobilization)

  • Map the interaction domains through mutation and deletion analysis

  • Determine if the interaction is regulated by neuronal activity or disease states

By implementing this systematic approach to interaction partner identification and validation, researchers will develop a comprehensive understanding of SYNGR4's functional network and potential roles in health and disease.

What evidence supports the role of SYNGR4 in ALS pathophysiology, and how can this be further investigated?

The upregulation of SYNGR4 in motor neurons coincident with symptom onset in mouse ALS models based on TDP-43 mutations represents a key finding suggesting SYNGR4's potential involvement in disease mechanisms . Importantly, this upregulation was observed across independent mouse models carrying different TDP-43 mutations (including hTDP-43Q331K), demonstrating that the effect is not model- or mutation-specific . This consistency strengthens the case for SYNGR4 as a relevant factor in ALS pathophysiology rather than an experimental artifact.

The temporal correlation between SYNGR4 upregulation and symptom onset is particularly significant. This timing suggests SYNGR4 may be involved in the transition from presymptomatic to symptomatic disease, a critical window for understanding disease mechanisms and developing therapeutic interventions. Additionally, the concurrent downregulation of PLEKHB1 observed in the same models points to coordinated changes in membrane trafficking pathways .

To further investigate SYNGR4's role in ALS pathophysiology, researchers should pursue several complementary approaches:

  • Human tissue validation:

    • Examine SYNGR4 expression in post-mortem spinal cord tissue from ALS patients compared to controls

    • Compare familial and sporadic ALS cases

    • Perform cell-type specific analyses focusing on motor neurons

    • Correlate SYNGR4 levels with disease duration and progression rates

  • Expanded animal model studies:

    • Extend investigations to additional ALS models (SOD1, C9orf72, FUS)

    • Perform detailed time-course analyses spanning presymptomatic through end-stage disease

    • Develop SYNGR4 reporter mice to monitor expression changes in real-time

  • Mechanistic studies:

    • Generate SYNGR4 knockout/knockin mice and cross with ALS models

    • Use viral vectors for motor neuron-specific manipulation of SYNGR4 levels

    • Determine effects on disease onset, progression, and survival

    • Examine motor neuron electrophysiology and synaptic function in these models

  • Molecular pathway analysis:

    • Identify SYNGR4-dependent trafficking pathways affected in ALS

    • Focus on the potential altered trafficking of GLP-1R and impact on neuroprotective signaling

    • Investigate relationship between SYNGR4 and TDP-43 pathology

    • Determine if SYNGR4 upregulation is TDP-43 dependent or represents a parallel pathway

These approaches will help determine whether SYNGR4 upregulation represents a protective response, a contributor to pathology, or a biomarker of disease processes, providing critical insights for potential therapeutic targeting.

How might alterations in SYNGR4-mediated vesicular trafficking contribute to neurodegeneration?

Alterations in SYNGR4-mediated vesicular trafficking may contribute to neurodegeneration through several mechanistic pathways, based on its proposed function in retrograde transport between endosomal compartments and the Trans-Golgi network . Understanding these potential pathways requires integrating knowledge of vesicular trafficking with neurodegeneration mechanisms.

Receptor Trafficking Dysregulation:
By analogy to SYNGR2/cellugyrin function, SYNGR4 appears to regulate intracellular retention of specific cargo proteins in "SYNGR4 vesicles" (S4Vs) . Upregulation of SYNGR4, as observed in ALS models , could enhance this retention, reducing surface expression of crucial receptors. If GLP-1R is indeed a cargo of SYNGR4 vesicles as suggested , its reduced surface availability would impair neuroprotective insulin signaling in the central nervous system. This mechanism aligns with growing evidence that metabolic dysfunction contributes to neurodegeneration in ALS and other conditions.

Protein Homeostasis Disruption:
Proper protein trafficking is essential for maintaining neuronal proteostasis. Dysregulated SYNGR4-mediated trafficking could:

  • Alter delivery of newly synthesized proteins to appropriate cellular compartments

  • Disrupt clearance of misfolded or aggregated proteins

  • Contribute to protein mislocalization, a common feature in neurodegenerative diseases

For example, if SYNGR4 regulates trafficking of proteins involved in autophagy or the ubiquitin-proteasome system, its upregulation could impair proteostatic mechanisms that normally protect against neurodegeneration.

Synaptic Dysfunction:
While SYNGR4 does not colocalize with classical synaptic vesicle markers in motor neurons , alterations in SYNGR4-mediated trafficking could indirectly affect synaptic function through:

  • Changed composition of synaptic membranes due to altered receptor trafficking

  • Impaired local protein synthesis due to disrupted cargo delivery

  • Disrupted signaling endosome function, critical for neurotrophin responses

This could contribute to the synaptic dysfunction that often precedes neuronal loss in neurodegenerative diseases.

Experimental Approaches to Test These Mechanisms:

To determine how SYNGR4 alterations contribute to neurodegeneration, researchers should:

  • Identify the complete repertoire of SYNGR4 vesicle cargoes in relevant neuronal populations using proximity labeling and proteomics

  • Compare trafficking kinetics of these cargoes in normal versus disease conditions

  • Determine the functional consequences of altered cargo trafficking through targeted manipulation

  • Test whether normalizing SYNGR4 levels in disease models restores normal trafficking and alleviates neurodegeneration

This systematic approach will establish whether SYNGR4-mediated trafficking represents a viable therapeutic target in neurodegenerative diseases.

What therapeutic strategies could target SYNGR4 or its pathways in neurodegenerative diseases?

Developing therapeutic strategies targeting SYNGR4 or its regulated pathways in neurodegenerative diseases requires first determining whether SYNGR4 upregulation, as observed in ALS models , represents a pathological mechanism to inhibit or a compensatory response to enhance. Based on current understanding of SYNGR4's function in retrograde vesicular trafficking and potential interaction with GLP-1R , several therapeutic approaches warrant investigation:

Direct SYNGR4 Modulation Strategies:

  • Small molecule modulators:

    • Screen for compounds that normalize SYNGR4-mediated trafficking

    • Target specific protein-protein interactions rather than expression levels

    • Develop assays measuring SYNGR4 vesicle movement or cargo retention/release

  • Antisense oligonucleotides (ASOs):

    • Design ASOs targeting SYNGR4 mRNA if downregulation is desired

    • Optimize for CNS delivery and motor neuron uptake

    • Test in ALS models to determine effects on disease progression

  • Gene therapy approaches:

    • Develop AAV vectors for neuron-specific SYNGR4 modulation

    • Design constructs with regulatory elements for controlled expression

    • Consider dual-targeting approaches to simultaneously modulate SYNGR4 and key interacting partners

Pathway-Based Interventions:

  • GLP-1R pathway targeting:

    • If SYNGR4 upregulation reduces GLP-1R surface expression , GLP-1R agonists could counteract this effect

    • Test established GLP-1R agonists (exenatide, liraglutide) in ALS models

    • Develop brain-penetrant GLP-1R agonists optimized for CNS delivery

    • Design biased agonists favoring neuroprotective signaling pathways

  • Vesicular trafficking modulation:

    • Target specific components of the retrograde trafficking machinery working with SYNGR4

    • Develop compounds that normalize endosome-TGN trafficking without directly targeting SYNGR4

    • Focus on shared trafficking pathways affected across neurodegenerative diseases

  • Metabolic support strategies:

    • If SYNGR4 upregulation impairs insulin signaling through GLP-1R retention , broader metabolic interventions may provide benefit

    • Consider insulin sensitizers or metabolic enhancers as adjunct therapies

Biomarker and Patient Selection:

For clinical translation, develop companion biomarkers:

  • Measure SYNGR4 levels in accessible patient samples (CSF, exosomes)

  • Identify downstream effects of SYNGR4 dysregulation detectable in biofluids

  • Use these biomarkers to select patients most likely to respond to SYNGR4-targeted therapies

Therapeutic Development Workflow:

PhaseApproachKey Considerations
Target ValidationGenetic manipulation in ALS modelsDetermine if SYNGR4 inhibition or enhancement is beneficial
Assay DevelopmentEstablish trafficking and signaling readoutsEnsure relevance to neurodegeneration mechanisms
Therapeutic DiscoveryScreen for small molecules or design biologicsBalance CNS penetration with specific targeting
Preclinical TestingTest in multiple disease modelsEvaluate effects on disease progression and neuronal function
Biomarker DevelopmentIdentify measurable correlates of target engagementPrepare for clinical translation

This systematic approach to therapeutic development addresses the critical steps needed to translate the basic understanding of SYNGR4 dysregulation into potential clinical interventions for neurodegenerative diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.