Recombinant Human Synaptophysin-like protein 1 (SYPL1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, kindly indicate your preference in the order notes. We will strive to accommodate your request.
Lead Time
Delivery timelines may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
As a standard practice, all our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for a maximum of one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specifications.
Synonyms
SYPL1; SYPL; Synaptophysin-like protein 1; Pantophysin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SYPL1
Target Protein Sequence
MAPNIYLVRQRISRLGQRMSGFQINLNPLKEPLGFIKVLEWIASIFAFATCGGFKGQTEI QVNCPPAVTENKTVTATFGYPFRLNEASFQPPPGVNICDVNWKDYVLIGDYSSSAQFYVT FAVFVFLYCIAALLLYVGYTSLYLDSRKLPMIDFVVTLVATFLWLVSTSAWAKALTDIKI ATGHNIIDELPPCKKKAVLCYFGSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSLHS PSNTSAPHSQGGIPPPTGI
Uniprot No.

Target Background

Gene References Into Functions
  1. Overexpression of SYPL1 is associated with poor prognosis in hepatocellular carcinoma (HCC). PMID: 28731154
  2. Synaptophysin I plays a role in the enduring neuroplasticity observed in the prefrontal cortical glutamate circuitry associated with ethanol dependence. PMID: 18720419
Database Links

HGNC: 11507

KEGG: hsa:6856

UniGene: Hs.80919

Protein Families
Synaptophysin/synaptobrevin family
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Melanosome.

Q&A

What is Human Synaptophysin-like protein 1 (SYPL1) and what are its basic characteristics?

SYPL1, also known as H-SP1 or SYPL, is a protein-coding gene (Entrez Gene ID: 6856) in humans that belongs to the synaptophysin family . It functions as a neuroendocrine-related protein with structural similarities to synaptophysin . The protein plays important roles in cellular processes including cell proliferation and survival pathways.

Key characteristics include:

FeatureDescription
Gene TypeProtein-coding
OrganismHomo sapiens (human)
SynonymsH-SP1, SYPL
Entrez Gene ID6856
Primary FunctionNeuroendocrine-related protein
Associated PathwaysCell cycle, DNA replication, p53 pathway

How should researchers design experiments to investigate SYPL1 function in cellular models?

When designing experiments to investigate SYPL1 function, researchers should follow a systematic approach:

  • Begin with a specific research question (e.g., "How does SYPL1 affect cell proliferation in pancreatic cancer cells?")

  • Define your variables clearly:

    • Independent variable: SYPL1 expression levels

    • Dependent variable: Cellular phenotype (proliferation, apoptosis, etc.)

    • Control for extraneous variables (cell culture conditions, passage number, etc.)

A foundational experimental design should include:

  • Comparison of multiple cell lines with varying baseline SYPL1 expression

  • Both gain-of-function and loss-of-function experiments

  • Appropriate controls (empty vector, scrambled siRNA/shRNA)

  • Multiple methods to measure the same outcome (e.g., CCK8 assay and colony formation for proliferation)

For example, researchers studying SYPL1 in PDAC successfully employed both lentiviral-mediated knockdown and overexpression models in BxPC-3 and PANC-1 cell lines, cultured at 37°C in 5% CO₂ with 10% fetal bovine serum supplementation .

What are recommended cell lines and culture conditions for studying recombinant SYPL1?

Based on published research, the following experimental systems have proven effective:

Cell LineDescriptionCulture ConditionsApplication
BxPC-3Human PDAC cell line37°C, 5% CO₂, 10% FBSKnockdown/overexpression studies
PANC-1Human PDAC cell line37°C, 5% CO₂, 10% FBSKnockdown/overexpression studies
CFPAC-1Human PDAC cell line37°C, 5% CO₂, 10% FBSExpression analysis
HPDE6-C7Immortal human pancreatic duct epithelial cell line37°C, 5% CO₂, 10% FBSNormal control comparison

These cell lines have been successfully used to study SYPL1 function in the context of pancreatic cancer research .

What is the role of SYPL1 in pancreatic ductal adenocarcinoma (PDAC) pathogenesis?

SYPL1 appears to play a significant role in PDAC pathogenesis based on multiple lines of evidence:

How can researchers effectively manipulate SYPL1 expression in experimental models?

Based on published methodologies, researchers can effectively manipulate SYPL1 expression using several approaches:

For SYPL1 Knockdown:

  • Lentiviral shRNA: Stable knockdown can be achieved using lentiviral vectors carrying shRNA targeting SYPL1. The validated target sequence "CCTCATAGGCGATTACTCT" has been successfully used in PDAC cell lines .

  • siRNA Transfection: Transient knockdown can be achieved using siRNA transfected with Lipofectamine 2000 following manufacturer's protocols .

For SYPL1 Overexpression:

  • Lentiviral Expression System: Stable overexpression can be established using lentiviral vectors carrying the SYPL1 coding sequence .

Verification of Manipulation:

Researchers should verify successful manipulation through:

  • Western blot analysis of protein expression

  • qRT-PCR for mRNA expression changes

  • Functional assays (proliferation, apoptosis, etc.) to confirm phenotypic changes

How should researchers design experiments to study SYPL1's role in apoptosis regulation?

To effectively investigate SYPL1's role in apoptosis regulation, researchers should employ a comprehensive experimental design:

  • Manipulation of SYPL1 Expression:

    • Use both knockdown (shRNA, siRNA) and overexpression systems

    • Include appropriate controls (scrambled shRNA, empty vector)

    • Verify expression changes by Western blot and qRT-PCR

  • Apoptosis Detection Methods (use at least two independent methods):

    • Flow cytometry with Annexin V/PI staining

    • TUNEL assay

    • Western blot analysis of apoptotic markers (cleaved caspase-3, cleaved PARP)

    • Mitochondrial membrane potential assessment

  • Mechanistic Investigation:

    • Measure ROS levels (e.g., using DCFH-DA probe)

    • Assess ERK activation status by Western blot (phospho-ERK vs. total ERK)

    • Use ROS scavengers (e.g., N-acetylcysteine) to determine if ROS mediates SYPL1's effects

    • Use ERK pathway inhibitors to assess pathway dependence

  • Timeline Considerations:

    • Include both early (6-24h) and late (24-72h) time points

    • Monitor pathway activation kinetics

This experimental framework will allow for comprehensive assessment of how SYPL1 regulates apoptosis and the intermediary pathways involved .

How can multi-omics data integration approaches be applied to SYPL1 research?

Vertical data integration methods can significantly enhance SYPL1 research by combining gene expression data with regulatory information:

  • Integration Approaches:

    • Decomposition-Integration Approach: This method explicitly exploits the regulation relationship and can effectively eliminate correlation. For example, the LRM-SVD approach considers the regulation model X=ηZ+E, where estimation is achieved using Lasso followed by sparse SVD (singular value decomposition) .

  • Application to SYPL1 Research:

    • Integrate SYPL1 expression data with:

      • DNA methylation profiles

      • miRNA expression data

      • Mutation data

      • Proteomic data

      • Metabolomic data

  • Clustering Analysis:

    • Methods like Clusternomics/BayesianCC, iCluster, and SNF can identify molecular subtypes based on integrated data .

    • For example, analyzing SYPL1 expression alongside other molecular features in PDAC samples could reveal distinct patient subgroups with different clinical outcomes.

  • Analysis Workflow:

    • Generate a correlation network between SYPL1 and potential regulators

    • Apply dimensionality reduction techniques

    • Identify key nodes and pathways connected to SYPL1

    • Validate findings through experimental approaches

This approach has been successfully applied in studies analyzing TCGA and PACA-AU datasets, where SYPL1's association with tumor characteristics and patient outcomes was established .

What are the best practices for analyzing contradictory data regarding SYPL1 expression across different cancer types?

When encountering contradictory data regarding SYPL1 expression or function across different cancer types or studies, researchers should follow these best practices:

  • Systematic Data Collection and Comparison:

    • Create a comprehensive table of SYPL1 expression patterns across multiple cancer types

    • Note the specific methodologies used in each study (IHC, RNA-seq, microarray)

    • Consider sample sizes and statistical power of each study

  • Context-Specific Analysis:

    • Recognize that SYPL1 may have context-dependent functions in different tissues

    • Consider tissue-specific binding partners or post-translational modifications

    • Analyze cell type-specific effects (e.g., epithelial vs. stromal expression)

  • Technical Validation:

    • Verify antibody specificity for SYPL1 detection

    • Cross-validate findings using multiple methodologies

    • Consider isoform-specific expression patterns

  • Functional Validation:

    • Design experiments to test SYPL1 function in multiple cell types

    • Use in vivo models representative of different cancer types

    • Consider patient-derived xenografts to maintain tumor heterogeneity

  • Mechanistic Resolution:

    • Investigate whether contradictory findings reflect differences in:

      • Underlying genetic background

      • Tumor microenvironment

      • Disease stage

      • Therapeutic interventions

This structured approach helps researchers reconcile apparently contradictory data and may reveal nuanced biological insights about SYPL1's role in cancer biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.