Recombinant Human Synaptoporin (SYNPR)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and protein stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
SYNPR; Synaptoporin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SYNPR
Target Protein Sequence
MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPT CEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV TVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSV VFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQ QASLGPTSDEFGQQPTGPTSFTNQI
Uniprot No.

Target Background

Function
Synaptoporin is an intrinsic membrane protein of small synaptic vesicles. It is likely a vesicular channel protein.
Gene References Into Functions
  1. Genome-wide association studies have identified the synaptoporin gene as one of the three susceptibility loci candidates for congenital left-sided lesions. PMID: 25138779
  2. Tyrosine nitration of synaptophysin is associated with amyloid beta-induced impairment of acetylcholine release. PMID: 12740598
  3. Cloning and characterization of the human cDNA encoding the human homologue of synaptoporin has been documented. PMID: 12974474
Database Links

HGNC: 16507

KEGG: hsa:132204

STRING: 9606.ENSP00000418994

UniGene: Hs.648668

Protein Families
Synaptophysin/synaptobrevin family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.

Q&A

What is Synaptoporin and how does it differ from other synaptophysin family members?

Synaptoporin (SYNPR), also known as Synaptophysin 2, is a component of the synaptic vesicle membrane that plays an important role in synaptic vesicle trafficking. While highly homologous to Synaptophysin 1, it differs significantly in expression patterns. Whereas Synaptophysin 1 is ubiquitously expressed throughout the brain, Synaptoporin shows a more restricted distribution, being concentrated primarily in the mossy fiber synapses of the hippocampus . This differential expression suggests specialized functions in specific neuronal circuits. The human SYNPR protein has a calculated molecular weight of 29 kDa (265 amino acids), but is typically observed at approximately 37-38 kDa on Western blots, likely due to post-translational modifications .

What are the recommended detection methods for Synaptoporin in experimental systems?

Multiple validated detection methods are available for Synaptoporin research, with specific protocols depending on your experimental system:

ApplicationRecommended DilutionSample TypesNotes
Western Blot (WB)1:500-5000 or 1:1000-1:6000Brain tissue (human, mouse, rat)37-38 kDa band expected
Immunohistochemistry (IHC)1:20-200 or 1:200-1:800Brain tissue, colon tissue, gliomasAntigen retrieval with TE buffer pH 9.0 recommended
Immunofluorescence (IF)1:50-200Various cell lines (U87, MCF-7, U251)Multiple publications have validated this approach
Immunoprecipitation (IP)0.5-4.0 μg for 1-3 mg total proteinBrain tissueUseful for protein interaction studies

When selecting antibodies, consider those validated across multiple applications with demonstrated specificity in your species of interest (human, mouse, rat) .

How should Synaptoporin antibodies be stored and handled for optimal performance?

For optimal antibody performance in Synaptoporin research, proper storage and handling are critical:

  • Long-term storage: Maintain at -20°C, where antibodies are typically stable for at least one year after shipment .

  • Working storage: For frequent use, refrigeration at 2-8°C is acceptable for up to 2 weeks .

  • Aliquoting: When antibodies contain 50% glycerol, aliquoting may be unnecessary for -20°C storage, reducing freeze-thaw cycles .

  • Buffer composition: Most commercial antibodies are supplied in PBS with preservatives like 0.02-0.03% sodium azide or Proclin 300, and 50% glycerol at pH 7.3-7.5 .

  • Thawing procedure: Allow antibodies to reach room temperature completely before opening to prevent moisture contamination.

Following these guidelines ensures maintained antibody reactivity and experimental reproducibility across your Synaptoporin research timeline .

How should experiments be designed to investigate Synaptoporin interactions with other synaptic proteins?

When designing experiments to investigate Synaptoporin interactions, consider a multi-methodological approach:

  • Co-immunoprecipitation assays: Use anti-Synaptoporin antibodies (0.5-4.0 μg per 1-3 mg of protein lysate) with brain tissue homogenates to pull down protein complexes. This approach has successfully identified protein interactions in similar synaptic proteins .

  • Density gradient fractionation: As demonstrated with α-synuclein and Rab3a interactions, glycerol density gradients can differentiate protein assemblies by size. Analyze fractions by Western blotting to identify Synaptoporin and potential binding partners co-migrating in specific molecular weight ranges .

  • Antibody blocking experiments: Similar to studies with α-synuclein, incubate synaptosomal membranes with specific antibodies against candidate interacting proteins before adding recombinant Synaptoporin. Reduced binding indicates potential interactions or spatial proximity .

  • Recombinant protein binding assays: Prepare synaptosomal membranes from SYNPR-deficient mice (if available), incubate with cytosol supplemented with recombinant SYNPR, then analyze membrane association through centrifugation and Western blotting .

  • Proximity ligation assays: For in situ detection of protein-protein interactions with spatial resolution below 40 nm, allowing visualization of interactions in native cellular contexts.

These approaches should be used complementarily to establish robust evidence for Synaptoporin interaction networks .

What controls should be included when studying Synaptoporin expression in neuronal systems?

Rigorous controls are essential for valid Synaptoporin expression studies:

  • Antibody validation controls:

    • Positive control: Mouse/rat brain tissue or human brain tissue where SYNPR is known to be expressed

    • Negative control: Non-neuronal tissues with minimal SYNPR expression

    • Antibody specificity control: Pre-incubation with immunizing peptide to demonstrate specific binding

    • Secondary antibody-only control: To exclude non-specific binding

  • Expression analysis controls:

    • Regional specificity control: Compare hippocampal mossy fiber regions (high expression) to other brain regions (lower expression)

    • Cell-type specific markers: Co-stain with markers for neuronal subtypes to confirm expected expression patterns

    • Loading control: Use housekeeping proteins (β-actin, GAPDH) for normalization in Western blots

  • Experimental manipulation controls:

    • Positive modulation control: Treatments known to alter synaptic protein expression

    • Vehicle control: For all treatments to account for solvent effects

    • Time-course control: Multiple time points to capture expression dynamics

  • Genetic manipulation controls:

    • Wild-type samples: Essential baseline for comparison

    • Knockdown validation: When using RNAi, validate knockdown efficiency by qPCR and Western blot

    • Off-target control: Use scrambled sequences or non-targeting constructs

These comprehensive controls ensure that observed differences in Synaptoporin expression are specific and biologically meaningful.

How can synergistic interactions between Synaptoporin and other risk factors be effectively evaluated in neurological disease models?

To evaluate synergistic interactions involving Synaptoporin in neurological disease models, implement the analytic framework for combinatorial perturbations as follows:

  • Experimental design for synergy detection:

    • Generate individual perturbations (SYNPR knockout, overexpression, or mutation)

    • Create combinatorial perturbations (SYNPR alteration + additional gene variant or environmental factor)

    • Include all necessary controls (wild-type, single perturbations, combined perturbations)

  • Transcriptomic analysis pipeline:

    • Perform RNA-sequencing on all conditions

    • Apply computational pipeline (available at https://github.com/nadschro/synergy-analysis) to distinguish additive from synergistic effects

    • Analyze raw read counts using the differential expression framework that specifically queries interactions between perturbagens

  • Quantification of synergistic effects:

    • Calculate expected additive effects from individual perturbations

    • Identify genes showing non-additive (synergistic) responses that exceed predicted additive effects

    • Conduct pathway enrichment analysis on synergistically affected genes to identify converging biological processes

  • Validation approaches:

    • Confirm key synergistic gene expression changes using qPCR

    • Assess functional consequences through electrophysiology, calcium imaging, or synaptic vesicle recycling assays

    • Test pharmacological rescue of synergistic phenotypes

This framework can reveal how Synaptoporin interacts with other disease-relevant factors, potentially uncovering convergent mechanisms in neurological disorders like has been demonstrated for psychiatric risk genes .

What methodologies are most effective for studying Synaptoporin's role in synaptic vesicle cycling?

To investigate Synaptoporin's role in synaptic vesicle cycling, combine these advanced methodologies:

  • Optical imaging of vesicle cycling:

    • pHluorin-based assays: Generate SYNPR-pHluorin fusion constructs to visualize exo/endocytosis cycles in live neurons

    • FM dye uptake/release: Quantify vesicle pool dynamics in neurons with modified SYNPR expression

    • Correlate findings with electrophysiological measurements of synaptic transmission

  • Biochemical fractionation approaches:

    • Isolate synaptic vesicles at different stages of the recycling process using density gradient centrifugation

    • Quantify SYNPR distribution across fractions relative to established markers of different vesicle pools

    • Compare wild-type with disease-associated SYNPR variants

  • Protein cycling analysis:

    • Leverage insights from the α-synuclein/Rab3a model, where membrane association/dissociation cycles are linked to synaptic activity

    • Investigate whether SYNPR membrane association is regulated by GTPase-dependent mechanisms similar to Rab3a

    • Test if SYNPR cycling is affected by GDI/Hsp90 complex inhibitors like radicicol and geldanamycin

  • CRISPR-based manipulation:

    • Generate GTPase-deficient mutants of potential SYNPR-interacting proteins

    • Create dominant-negative GDP dissociation inhibitor mutants to test effects on SYNPR membrane association

    • Apply the synergy analysis framework to distinguish direct vs. indirect effects on vesicle cycling

These methodologies should be integrated to build a comprehensive understanding of Synaptoporin's dynamic role in the synaptic vesicle cycle.

How can inconsistent Synaptoporin antibody detection results be resolved across different experimental systems?

When facing inconsistent Synaptoporin antibody detection results, implement this systematic troubleshooting approach:

  • Sample preparation optimization:

    • For Western blots: Test different lysis buffers, particularly those optimized for membrane proteins (containing 0.5-1% NP-40 or Triton X-100)

    • For immunohistochemistry: Compare multiple antigen retrieval methods, specifically testing both citrate buffer pH 6.0 and TE buffer pH 9.0 as recommended for SYNPR detection

    • For all applications: Ensure complete protein denaturation and appropriate protein concentration

  • Antibody selection and validation:

    • Test multiple antibodies targeting different epitopes of SYNPR

    • Verify antibody specificity using positive controls (brain tissue) and negative controls

    • Consider the observed molecular weight (37-38 kDa) versus calculated weight (29 kDa) when interpreting bands

  • Application-specific optimizations:

    ApplicationCommon IssueOptimization Strategy
    Western BlotWeak signalExtend primary antibody incubation to overnight at 4°C; test 1:1000-1:6000 dilution range
    IHCHigh backgroundTest more dilute antibody (1:500-1:800); increase blocking time; use specific blocking reagents
    IFNonspecific stainingOptimize fixation method; increase antibody dilution (1:100-1:200); include additional washing steps
    IPPoor pull-downIncrease antibody amount (up to 4.0 μg for 3.0 mg protein); extend incubation time
  • Species-specific considerations:

    • Confirm antibody reactivity with your species of interest (human, mouse, rat)

    • Be aware that antibody performance may vary between species despite sequence homology

    • Use well-characterized positive control samples from the same species

By methodically addressing these factors, reliable and consistent SYNPR detection can be achieved across experimental systems.

How should researchers interpret apparent discrepancies between mRNA and protein expression data for Synaptoporin?

When confronting discrepancies between Synaptoporin mRNA and protein expression data, consider these analytical approaches:

  • Post-transcriptional regulation assessment:

    • Investigate microRNA regulation: Identify miRNAs that target SYNPR mRNA using prediction tools and validate through reporter assays

    • Analyze mRNA stability: Measure SYNPR mRNA half-life using actinomycin D chase experiments

    • Examine alternative splicing: Use RT-PCR with primers spanning potential splice junctions to identify isoforms that may be differentially translated

  • Protein stability and turnover evaluation:

    • Conduct pulse-chase experiments with metabolic labeling to determine SYNPR protein half-life

    • Apply proteasome inhibitors (MG132) and lysosomal inhibitors (bafilomycin A1) to identify degradation pathways

    • Investigate post-translational modifications that might affect stability or antibody recognition

  • Methodological reconciliation approach:

    • Normalize protein detection methods: Ensure antibodies detect all SYNPR isoforms; consider using multiple antibodies targeting different epitopes

    • Validate mRNA detection: Design qPCR primers capturing all transcript variants; confirm specificity through sequencing

    • Temporal resolution: Account for time lag between transcription and translation through time-course experiments

  • Biological interpretation framework:

    • Spatial considerations: SYNPR mRNA may be detected in neuronal cell bodies while protein localizes to distant synaptic terminals

    • Functional state analysis: Investigate whether certain stimuli cause translational activation of pre-existing mRNA pools

    • Developmental timing: Compare mRNA/protein relationships across developmental stages when synaptic composition is changing

These approaches provide a comprehensive framework for interpreting and resolving apparent discrepancies, potentially revealing important regulatory mechanisms controlling Synaptoporin expression.

How can Synaptoporin research contribute to understanding synaptic dysfunction in neurodegenerative diseases?

Synaptoporin research offers multiple avenues for elucidating synaptic dysfunction in neurodegenerative diseases:

  • Synergistic interaction studies:

    • Apply the combinatorial perturbation framework to study interactions between SYNPR and established neurodegenerative disease risk factors

    • Investigate potential synergistic effects exceeding additive impacts, as demonstrated in studies of psychiatric risk genes

    • Focus on convergent pathways affecting synaptic function that emerge from these interactions

  • Synaptic vesicle cycling mechanisms:

    • Examine whether SYNPR, like α-synuclein, partners with Rab3a-related machinery in synaptic vesicle cycling

    • Investigate if impairments to SYNPR's interactions with vesicles affect neurodegeneration

    • Test whether treatments that inhibit Rab GTPase recycling also affect SYNPR membrane association

  • Hippocampal mossy fiber analysis:

    • Given SYNPR's concentration in mossy fiber synapses, focus on this region's vulnerability in neurodegenerative diseases

    • Correlate SYNPR expression changes with hippocampal dysfunction in disease models

    • Investigate associations between microglia, inflammatory factors, complement, and loss of SYNPR-expressing mossy fiber synapses

  • Biomarker development approach:

    • Evaluate SYNPR as a potential biomarker for synaptic integrity in neurodegenerative disorders

    • Develop assays to detect soluble SYNPR fragments in CSF as indicators of synaptic degeneration

    • Correlate SYNPR levels or modifications with disease progression and cognitive decline

These research directions could significantly enhance our understanding of how synaptic dysfunction contributes to neurodegenerative disease pathogenesis, potentially identifying new therapeutic targets focused on preserving synaptic integrity .

What novel methodological approaches could advance Synaptoporin functional studies in human stem cell-derived neurons?

To advance Synaptoporin functional studies in human stem cell-derived neurons, these innovative methodological approaches should be considered:

  • CRISPR-based genome editing framework:

    • Generate isogenic hiPSC lines with SYNPR mutations, deletions, or tagged variants

    • Create reporter lines with fluorescently labeled SYNPR to track localization and dynamics

    • Implement the combinatorial perturbation approach to test interactions between SYNPR and other disease-relevant genes

  • Advanced imaging technologies:

    • Apply super-resolution microscopy (STORM, PALM) to visualize SYNPR within the spatial context of synaptic vesicle pools

    • Implement live-cell imaging with SYNPR-pHluorin constructs to monitor vesicle cycling in real-time

    • Use correlative light and electron microscopy to connect SYNPR dynamics with ultrastructural changes

  • Single-cell multi-omics integration:

    • Combine single-cell transcriptomics, proteomics, and functional imaging of the same neurons

    • Apply patch-seq approaches (patch-clamp electrophysiology followed by single-cell RNA-seq) to correlate SYNPR expression with functional properties

    • Develop computational frameworks to integrate these multi-modal datasets

  • Microfluidic compartmentalization technologies:

    • Culture hiPSC-derived neurons in microfluidic devices separating somata from axons/synapses

    • Apply local manipulation of SYNPR at synapses while monitoring effects on distant compartments

    • Test activity-dependent regulation of SYNPR trafficking between compartments

  • Synaptically-connected organoid systems:

    • Develop brain organoid systems with verifiable SYNPR-expressing synapses

    • Implement the synergy analysis pipeline to identify convergent and divergent effects of perturbations

    • Create chimeric organoids to study SYNPR function at specific circuit interfaces

These approaches, particularly when implemented within the combinatorial perturbation framework, would significantly advance our understanding of SYNPR function in human neurons and its relevance to neurological disorders .

How can researchers integrate Synaptoporin studies across multiple experimental systems to build a comprehensive understanding of its function?

To build a comprehensive understanding of Synaptoporin function, researchers should implement this integrated multi-system approach:

  • Cross-platform validation strategy:

    • Validate key findings across different model systems (cell lines, primary neurons, hiPSC-derived neurons, brain slices, in vivo models)

    • Compare SYNPR expression, localization, and function across species (human, mouse, rat) to identify conserved and divergent features

    • Use consistent methodologies and antibodies across systems to enable direct comparisons

  • Multi-scale analysis framework:

    • Molecular scale: Protein-protein interactions, post-translational modifications, structural studies

    • Cellular scale: Subcellular localization, trafficking dynamics, synaptic vesicle association

    • Circuit scale: Region-specific functions, particularly in hippocampal mossy fibers

    • Systems scale: Behavioral consequences of SYNPR disruption

  • Data integration approach:

    • Implement a centralized data repository for SYNPR findings

    • Develop computational models integrating findings from multiple experimental systems

    • Apply the synergy analysis pipeline to identify consistent patterns across datasets

  • Collaborative research consortium model:

    • Establish standardized protocols for SYNPR studies

    • Distribute validated reagents (antibodies, constructs, cell lines) among research groups

    • Coordinate complementary approaches among labs with different technical expertise

  • Translational pipeline implementation:

    • Connect basic SYNPR findings to clinical observations

    • Develop biomarkers based on consistent SYNPR alterations

    • Test therapeutic approaches targeting SYNPR or associated pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.