Recombinant Human Syntaxin-1B (STX1B)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methods

Recombinant human STX1B can be expressed in various systems, with HEK-293 cells being a common mammalian expression system. This approach allows for proper post-translational modifications and protein folding. The recombinant protein is typically tagged, often with a histidine tag (His-tag), to facilitate purification through affinity chromatography .

The purity of commercially available recombinant STX1B typically exceeds 90%, as determined by Bis-Tris Page and Western Blot analyses. These protein preparations are suitable for various applications including SDS-PAGE and Western Blotting .

Table 1: Characteristics of Recombinant Human Syntaxin-1B Protein

PropertyDescription
Full Length288 amino acids (AA 1-288)
Expression SystemHEK-293 Cells
Purification TagHis tag
Purity> 90% as determined by Bis-Tris Page, Western Blot
ApplicationsSDS-PAGE, Western Blotting
Subcellular LocalizationPlasma membrane of neuronal tissues

Biological Functions of STX1B

Syntaxin-1B serves as a fundamental component of the neuronal exocytotic machinery, participating in the SNARE complex that mediates synaptic vesicle fusion with the presynaptic membrane . This process is essential for neurotransmitter release and synaptic transmission.

Differential Role from Syntaxin-1A

One critical difference is that while STX1A knockout mice can survive, STX1B knockout mice experience premature death, indicating that STX1B plays essential roles that cannot be compensated by STX1A . This finding underscores the unique importance of STX1B in neuronal function and survival.

Role in Neuromuscular Junctions

Studies have demonstrated that STX1B is crucial for maintaining efficient neurotransmission at neuromuscular junctions (NMJs). While STX1B appears dispensable for the formation of mouse NMJs, it is required to maintain the efficiency of neurotransmission at these nerve-muscle synapses . This highlights STX1B's importance in peripheral nervous system function.

Neuronal Survival and Development

Research using cerebellar cultures has shown that STX1B is essential for neuronal survival in vitro. Cultures derived from STX1B knockout mice exhibited a decrease in spontaneous GABAergic transmission frequency, which was attributed to a lower number of neurons in these cultures . This suggests that STX1B plays a critical role in maintaining neuronal viability.

STX1B-Related Disorders

Mutations in the STX1B gene are associated with a spectrum of epilepsy syndromes, ranging from benign conditions to severe developmental and epileptic encephalopathies .

Phenotypic Spectrum

Research has identified several distinct phenotypic groups associated with STX1B variants:

Table 2: Phenotypic Groups Associated with STX1B Variants

GroupClinical FeaturesVariant Types
Group 1Febrile and afebrile seizures with benign course, good drug response, normal developmentOften loss-of-function mutations
Group 2Genetic generalized epilepsy without febrile seizures and cognitive deficitsVarious
Group 3Intractable seizures, developmental regression, neuropsychiatric symptomsOften missense variants in SNARE motif
Group 4Focal epilepsyVarious

This diversity of phenotypes places STX1B-related disorders on a continuum that spans the International League Against Epilepsy classification .

Genotype-Phenotype Correlations

Research has identified important correlations between specific types of STX1B mutations and clinical presentations. Loss-of-function mutations are more frequently associated with benign epilepsy syndromes, whereas missense variants in the SNARE motif of syntaxin-1B tend to result in more severe phenotypes with developmental regression and intractable seizures .

This pattern suggests that different molecular mechanisms may underlie the various STX1B-related disorders, with complete loss of function potentially having less severe consequences than altered protein function through specific missense mutations.

Research Applications of Recombinant STX1B

Recombinant STX1B serves as a valuable tool for investigating neuronal function and disease mechanisms. Its applications include:

Protein Interaction Studies

Recombinant STX1B enables the investigation of protein-protein interactions within the SNARE complex and with regulatory proteins. These studies help elucidate the molecular mechanisms of synaptic vesicle fusion and neurotransmitter release.

Functional Assays

Recombinant STX1B is used in functional assays to assess the impact of specific mutations on protein function. This approach helps establish genotype-phenotype correlations and understand the pathophysiology of STX1B-related disorders.

Therapeutic Approaches Targeting STX1B-Related Disorders

Recent advances have led to the development of potential therapeutic strategies for STX1B-related disorders.

Gene Therapy Approaches

An innovative gene therapy candidate, CAP-002, is being developed for developmental and epileptic encephalopathy related to syntaxin-binding protein 1 (STXBP1) mutations, which interact with the STX1B pathway . While this therapy does not directly target STX1B, it demonstrates the potential for gene-based approaches in treating related synaptic disorders.

Preclinical data in non-human primates and human cells have shown promising results, with CAP-002 demonstrating the ability to restore protein levels and correct neuronal network activity . This approach is expected to enter clinical trials in 2025 and has received Orphan Drug Designation from the FDA .

Implications for STX1B-Focused Therapies

The success of related synaptic protein therapies suggests that similar approaches might be effective for STX1B-related disorders. Given the different phenotypic presentations associated with various types of STX1B mutations, personalized therapeutic strategies may be necessary to address the specific molecular defects in each case.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
STX1B; STX1B1; STX1B2; Syntaxin-1B; Syntaxin-1B1; Syntaxin-1B2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL
Uniprot No.

Target Background

Function
Syntaxin-1B (STX1B) is potentially involved in docking synaptic vesicles at presynaptic active zones. It may also mediate Ca(2+)-regulation of exocytosis and acrosomal reaction in sperm.
Gene References Into Functions
  1. Genetic variations in STX1B, DNMT3A, and CYP1A1 influence warfarin maintenance dosage. PMID: 27740732
  2. Transcranial magnetic stimulation measures of motor cortex excitability show normal excitability in adult STX1B mutation carriers with a history of seizures. PMID: 29101845
  3. Genotyping was performed for 529 adults (n = 325 European-Americans, 204 Egyptians) on a stable warfarin dose for GGCX rs12714145 and rs10654848, FPGS rs7856096, and STX1B rs4889606. PMID: 26751406
  4. Findings indicate that STX1B rs4889603, FAM47E rs6812193, and SCARB2 rs6825004 do not significantly contribute to the risk of Parkinson's disease. PMID: 26224037
  5. The data suggests that STX1B polymorphisms are associated with Parkinson disease etiology. PMID: 25534083
  6. Single nucleotide polymorphisms (SNPs) in the 3'-untranslated region of the fucosyltransferase 1 (FUT1) gene and intron of the syntaxin 1B (STX1B) gene were identified as top hits for Kawasaki disease (KD) susceptibility. PMID: 25101798
  7. STX1B and the presynaptic release machinery may play a role in fever-associated epilepsy syndromes. PMID: 25362483
  8. The STX1B-Delta transmembrane domain is characterized as the first nucleoplasmic syntaxin lacking a transmembrane domain. PMID: 18691641

Show More

Hide All

Database Links

HGNC: 18539

OMIM: 601485

KEGG: hsa:112755

STRING: 9606.ENSP00000215095

UniGene: Hs.542230

Involvement In Disease
Generalized epilepsy with febrile seizures plus 9 (GEFSP9)
Protein Families
Syntaxin family
Subcellular Location
[Isoform 1]: Membrane; Single-pass type IV membrane protein.; [Isoform 2]: Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Note=Colocalizes with Lamin A/C and NuMA in interphasic nuclei, and with NuMA and gamma-tubulin in the pericentrosomal region of the mitotic spindle in dividing cells.

Q&A

What is the molecular structure of human Syntaxin-1B and how does it differ from other syntaxin family members?

Human Syntaxin-1B is a single-pass type IV transmembrane protein of approximately 33 kDa. Its cytoplasmic domain contains a coiled-coil Syntaxin domain (amino acids 29-180) implicated in synaptic vesicle docking with the presynaptic plasma membrane, and a t-SNARE coiled-coil domain (amino acids 191-253) . The protein shows remarkable conservation across species, with the cytoplasmic domain of human STX1B sharing 100% amino acid sequence identity with mouse and rat STX1B .

Unlike other syntaxin family members that function in different cellular compartments, STX1B is specifically enriched at presynaptic active zones and functions primarily in neurotransmitter release. While Syntaxin-1A and Syntaxin-1B have overlapping functions, genetic studies have demonstrated that they are not completely redundant, as STX1B knockout mice show postnatal lethality even when STX1A is present .

How does recombinant STX1B compare to native STX1B in experimental applications?

Recombinant STX1B typically refers to the protein produced in heterologous expression systems, most commonly in E. coli. The commercially available recombinant human STX1B usually contains portions of the cytoplasmic domain (e.g., Lys2-Lys264) without the transmembrane domain, which improves solubility and facilitates purification.

When designing experiments with recombinant STX1B, researchers should consider:

  • The lack of post-translational modifications that may be present in native STX1B

  • The potential absence of the transmembrane domain in recombinant preparations

  • The possible requirement for reconstitution into lipid environments for functional studies

For applications requiring full-length protein including the transmembrane domain, mammalian expression systems may be preferable, as demonstrated in studies using lentiviral expression vectors under the neuron-specific synapsin promoter .

What are the optimal methods for detecting STX1B in western blots and immunohistochemistry?

For western blot detection of STX1B:

  • Protein extraction from neuronal tissues or cultures using buffers containing:

    • 50 mM Tris/HCl, pH 7.6

    • 150 mM NaCl

    • 1% Nonidet P-40

    • 0.5% sodium deoxycholate

    • 250 μM PMSF

    • Protease inhibitor cocktail

  • SDS-PAGE separation followed by transfer to PVDF membrane

  • Probing with specific antibodies:

    • Mouse Anti-Human/Mouse/Rat STX1B Monoclonal Antibody at 1 μg/mL

    • HRP-conjugated secondary antibodies

  • STX1B appears as a specific band at approximately 33 kDa under reducing conditions

For immunohistochemistry applications, STX1B can be detected in fixed brain sections, with particularly strong expression in hippocampus and cerebellum regions .

How can I effectively manipulate STX1B expression levels in neuronal cultures?

Several approaches have proven effective for experimental manipulation of STX1B expression:

  • Lentiviral transduction: Lentiviral vectors containing STX1B cDNA under the control of neuron-specific synapsin promoter provide efficient expression in primary neuronal cultures. This approach allows for rescue experiments in STX1B-deficient neurons .

  • RNA interference: STX1B-specific shRNA can effectively reduce expression. An example target sequence is 5′-GAT CCC AGG CAC AAT GAG ATC ATC AAA-3′, which can be cloned into vectors under U6 promoter control .

  • Genetic titration: The use of knock-in mouse lines expressing fusion proteins (e.g., STX1B-YFP) can create hypomorphic alleles with reduced expression levels, allowing for the study of dose-dependent effects .

  • Expression verification: Protein lysates from transduced cultures should be analyzed by immunoblotting to confirm altered expression levels .

How does the genetic titration of STX1B affect neurotransmitter release parameters?

Studies employing genetic titration of STX1B have revealed several key functional relationships:

  • Evoked neurotransmitter release: Severe reduction of STX1B levels (in STX1B^yfp/yfp;STX1A^-/- neurons) causes an approximately 80% decrease in EPSC amplitude (0.49 nA vs. 3.7 nA in controls) and ~30% longer EPSC rise times (2.5 s vs. 1.9 s in controls) .

  • Spontaneous release: Miniature EPSC frequency is reduced by ~70% in STX1B-deficient neurons (0.64 s^-1 vs. 3.7 s^-1 in controls) .

  • Readily Releasable Pool (RRP): STX1B reduction leads to ~65% smaller RRP charge (0.30 nC vs. 1.07 nC in controls) and slower refilling kinetics (τ = 4.1 s vs. 1.5 s in controls) .

  • Dose-dependency: Heterozygous neurons (STX1B^+/yfp;STX1A^-/-) show normal release properties, indicating that one wild-type copy of STX1B is sufficient for normal function, suggesting a threshold effect rather than strict dose-dependence .

What experimental approaches can be used to study STX1B's role in the readily releasable pool (RRP) dynamics?

To investigate STX1B's influence on RRP characteristics, researchers can employ several methodologies:

  • Hypertonic sucrose application: This calcium-independent method measures RRP size by applying hypertonic solution (typically 500 mM sucrose) to trigger the fusion of primed vesicles. The resulting postsynaptic current reflects the size of the RRP .

  • Paired sucrose applications: To measure RRP refilling kinetics, apply two consecutive applications of hypertonic solution at increasing time intervals. The fraction of recovery at different intervals can be fitted to a single exponential equation to derive time constants (τ) for refilling .

  • Combined with genetic manipulations: These approaches can be performed in neurons with manipulated STX1B levels (knockdown, knockout, overexpression) to determine how STX1B influences RRP size and refilling kinetics.

  • Electrophysiological parameters: When analyzing results, researchers should focus on:

    • RRP charge (measured in nanocoulombs)

    • Recovery time constants (measured in seconds)

    • Paired-pulse ratios at different intervals

How do STX1B knockout models differ from STX1A knockout models in terms of neuronal function and survival?

The functional differences between STX1A and STX1B knockouts reveal distinct roles for these closely related isoforms:

  • Postnatal survival: STX1B knockout mice show postnatal lethality, while STX1A knockout mice are viable, indicating a more essential role for STX1B in vivo .

  • Neuronal survival: STX1B appears critical for neuronal survival in vitro, as high-density cerebellar cultures from STX1B knockout mice show decreased neuronal numbers .

  • Neurotransmitter release: While both proteins participate in the SNARE complex for vesicle fusion, genetic studies using STX1B^yfp/yfp;STX1A^-/- models demonstrate that STX1A cannot fully compensate for reduced STX1B levels, suggesting unique functions for STX1B in vesicle priming and fusion .

  • Neuromuscular junction (NMJ): STX1B is dispensable for NMJ formation but required for maintaining efficient neurotransmission at the nerve-muscle synapse, demonstrating tissue-specific requirements .

What are the key binding partners of STX1B in neurotransmitter release, and how can these interactions be studied?

STX1B interacts with several proteins crucial for neurotransmitter release:

  • SNARE complex components: STX1B forms the SNARE complex with SNAP-25 and synaptobrevin/VAMP to mediate vesicle fusion .

  • Munc18-1 (Syntaxin-BP1): This key regulatory protein (also known as STXBP1) binds to STX1B and plays a critical role in vesicle priming and fusion. Munc18-1 can be detected as a 67 kDa protein in brain lysates using specific antibodies .

  • Pallidin and snapin: These components of the dysbindin-containing complex (BLOC-1) can interact with STX1B, suggesting roles beyond the canonical SNARE function .

Methodological approaches to study these interactions include:

  • Co-immunoprecipitation: Using antibodies against STX1B to pull down interaction partners from brain lysates .

  • Affinity "pulldown" assays: Immobilizing recombinant forms of candidate binding partners onto beads and assessing binding of STX1B from brain cytosol .

  • Size-exclusion chromatography: To determine whether STX1B exists in stable complexes and to characterize the size of these complexes .

  • Rescue experiments: Using 2A peptide-linked multicistronic vectors to express both STX1B and interaction partners (e.g., Munc18-1) for functional rescue studies .

How does the conformation of STX1B regulate its interactions with other SNARE proteins?

STX1B undergoes conformational changes that regulate its availability for SNARE complex formation:

  • Closed conformation: In this state, the N-terminal Habc domain folds back onto the SNARE motif, preventing interactions with other SNARE proteins. This conformation is stabilized by binding to Munc18-1 .

  • Open conformation: When STX1B adopts an open conformation, the SNARE motif becomes available for complex formation with SNAP-25 and synaptobrevin/VAMP .

  • Experimental approaches: Studies have utilized mouse models expressing constitutively open forms of STX1 (with L165A, E166A "open-form" mutations) to investigate how this conformational switch affects synaptic properties .

  • Functional consequences: The conformational state of STX1B influences vesicle priming rates and neurotransmitter release probability, with the open conformation generally facilitating more efficient release .

What is the potential relevance of STX1B in neurological disorders and how can recombinant STX1B be used to study these conditions?

STX1B has been implicated in several neurological disorders:

  • Epilepsy: Mutations in STX1B have been associated with certain forms of epilepsy, suggesting its importance in regulating neuronal excitability.

  • STXBP1 encephalopathy: While this condition primarily involves mutations in the STX1B-binding partner STXBP1 (Munc18-1), understanding the STX1B-STXBP1 interaction is crucial for comprehending the molecular mechanisms of the disease .

  • Schizophrenia: The dysbindin-containing complex (BLOC-1), which interacts with STX1B, has been implicated in schizophrenia pathogenesis, suggesting potential roles for STX1B in this disorder .

Recombinant STX1B can be utilized in these research contexts through:

  • In vitro binding assays: To characterize how disease-associated mutations affect interactions with binding partners .

  • Cell-based assays: Introducing recombinant STX1B or mutant variants into neuronal cultures to assess effects on neurotransmitter release .

  • Animal models: Generating knock-in mice expressing disease-associated mutations to study their effects on neurological function in vivo .

How can the developmental regulation of STX1B expression be studied, and what are its implications for neurodevelopmental disorders?

STX1B shows developmental regulation of expression, with potential implications for neurodevelopmental disorders:

  • Age-dependent expression patterns: Studies have shown age-dependent changes in STX1B expression in the brain, suggesting developmental roles .

  • Methodological approaches:

    • Immunoblotting of brain tissues from different developmental stages

    • RT-PCR analysis of mRNA levels across development

    • Primary neuronal cultures maintained for different durations

  • Functional implications: The developmental regulation of STX1B suggests potential roles in synapse formation, maturation, and pruning during brain development .

  • Research applications:

    • Investigating how STX1B level alterations during critical developmental periods affect neuronal connectivity

    • Studying whether abnormal STX1B expression contributes to neurodevelopmental disorders

    • Examining potential therapeutic strategies targeting the STX1B pathway during specific developmental windows

What are the optimal expression systems and purification strategies for producing functional recombinant human STX1B?

For successful production of recombinant human STX1B:

  • Expression systems:

    • E. coli: Most commonly used for producing the cytoplasmic domain (e.g., Lys2-Lys264)

    • Mammalian systems: Preferred for full-length protein including the transmembrane domain

    • Lentiviral vectors: Effective for expression in neurons under synapsin promoter control

  • Purification strategies:

    • Affinity tags: His-tag or GST-tag for efficient purification

    • Consideration of the hydrophobic transmembrane domain, which may require detergent solubilization

    • Size-exclusion chromatography as a final purification step

  • Functional verification:

    • Binding assays with known interaction partners (e.g., SNAP-25, Munc18-1)

    • Liposome reconstitution for transmembrane domain-containing constructs

    • Rescue of function in STX1B-deficient neurons

What controls should be included when studying the function of recombinant STX1B in neuronal systems?

When investigating STX1B function using recombinant proteins, the following controls are essential:

  • Expression level verification:

    • Immunoblotting to confirm expression levels relative to endogenous protein

    • Quantification using appropriate housekeeping proteins (e.g., β-tubulin III)

  • Localization controls:

    • Immunocytochemistry to confirm proper subcellular localization

    • For fluorescently tagged constructs, verification that the tag doesn't interfere with function

  • Rescue experiments:

    • Using wild-type STX1B to rescue STX1B-deficient neurons

    • Comparing with STX1A rescue to assess isoform specificity

  • Negative controls:

    • Inactive mutants (e.g., SNARE domain mutants)

    • Empty vector controls

  • Positive controls:

    • Known functional effects (e.g., RRP size, neurotransmitter release parameters)

    • Comparison with endogenous protein function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.