Recombinant Human Syntaxin-2 (STX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributor for precise delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To prevent degradation, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
STX2; EPIM; STX2A; STX2B; STX2C; Syntaxin-2; Epimorphin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK
Uniprot No.

Target Background

Function
Syntaxin-2 plays a crucial role in epithelial morphogenesis. It may mediate Ca(2+)-regulated exocytosis and the acrosomal reaction in sperm.
Gene References Into Functions
  1. Munc134 mediates human neutrophil elastase-induced airway mucin5AC hypersecretion by interacting with syntaxin2. PMID: 29767240
  2. TGF-beta, bFGF, and epimorphin in the extracellular microenvironment cooperatively affect HSF behaviors under the control of a highly sulfated chondroitin sulfate. PMID: 28209294
  3. The effects of HIV/HCV co-infection on hepatic fibrosis may be partially mediated by epimorphin (EPM). Strategies to limit EPM expression could represent a novel therapeutic approach to prevent hepatic fibrosis progression during HIV/HCV co-infection. PMID: 27362846
  4. Three loci associated with circulating tPA levels have been identified: the PLAT region, STXBP5, and STX2. Functional studies suggest a novel role for STXBP5 and STX2 in regulating tPA release. PMID: 24578379
  5. Epimorphin can revert ovarian cancer cells away from their mesenchymal phenotype and towards an epithelial phenotype. PMID: 24039787
  6. Genetic variation in STX2 is associated with von Willebrand factor:Ag levels in patients diagnosed with type 1 von Willebrand Disease. PMID: 22792389
  7. EPM, secreted by activated stellate cells within stroma, promotes invasion and metastasis of hepatocellular cancer cells by activating MMP-9 expression through the FAK-ERK pathway. PMID: 22045676
  8. Genetic variability in STXBP5 and STX2 affects both VWF concentration and activity in young individuals with premature arterial thrombosis. PMID: 21156930
  9. Munc18b binds to syntaxins 1A, 2, and 3 and regulates vesicle transport to the apical plasma membrane. PMID: 12198139
  10. These findings suggest that epimorphin contributes to repair of pulmonary fibrosis in nonspecific interstitial pneumonia, possibly by inducing expression of matrix metalloproteinase 2, which is an important proteolytic factor in lung remodeling. PMID: 15651999
  11. Expression of SNAP-23 and syntaxin-2 is observed on the extracellular surface of the platelet plasma membrane. PMID: 17485553
  12. Inadequate epimorphin elicits an abnormal differentiation response in keratinocytes, indicating a causal function of the epimorphin signaling gradient for the establishment of differentiated epidermal structure in the skin. PMID: 18273050
  13. Homology with vesicle fusion mediator syntaxin-1a predicts determinants of epimorphin/syntaxin-2 function in mammary epithelial morphogenesis. (PMID: 19129200

Show More

Hide All

Database Links

HGNC: 3403

OMIM: 132350

KEGG: hsa:2054

STRING: 9606.ENSP00000376178

UniGene: Hs.437585

Protein Families
Syntaxin family
Subcellular Location
Membrane; Single-pass type IV membrane protein.

Q&A

What is Syntaxin-2 (STX2) and what cellular functions does it serve?

Syntaxin-2 (STX2) belongs to the syntaxin/epimorphin family of proteins that are implicated in the targeting and fusion of intracellular transport vesicles. It functions as a crucial epithelial mediator across numerous physiological processes and disease states. The protein contains 287 amino acids in its full-length form (isoform 1) and includes a characteristic t-SNARE coiled-coil homology domain that facilitates its involvement in membrane fusion events. STX2 plays essential roles in regulating epithelial-mesenchymal interactions and contributes significantly to epithelial cell morphogenesis and activation processes. Its functions extend beyond basic vesicular transport to include regulatory roles in cellular migration, invasion, and proliferation, particularly in specialized cell types such as trophoblasts during placental development. STX2's subcellular localization primarily at the cytomembrane and cytoplasm further supports its function in membrane-associated processes.

What are the structural characteristics and isoforms of human STX2?

Human STX2 exists in multiple isoforms resulting from alternative splicing, with isoform 1 being the predominant form studied in research contexts. The full amino acid sequence of human STX2 (isoform 1) consists of 287 residues with the sequence: MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERnvmnatdyvehakeetkkaikyqskarrklmfiiicvivllvilgiilattls. The protein features a t-SNARE coiled-coil homology domain that is critical for its function in SNARE complex formation and subsequent membrane fusion events. The molecular weight of the recombinant protein with proprietary tags is approximately 57.64 kDa, though the native protein is smaller. Multiple isoforms (STX2A, STX2B, STX2C) have been identified, which may exhibit tissue-specific expression patterns and functional variations, though these distinctions remain an active area of investigation. The protein's structural features facilitate its interactions with various binding partners, including PI3K regulatory subunits, as demonstrated through co-immunoprecipitation and GST pull-down assays.

How is recombinant human STX2 optimally stored and handled in laboratory settings?

Recombinant human STX2 requires specific storage conditions to maintain its structural integrity and functional activity. The protein is typically shipped on dry ice and should be immediately aliquoted upon receipt to minimize freeze-thaw cycles. Long-term storage is recommended at -80°C, as repeated freeze-thaw cycles can cause protein degradation and loss of activity. When working with the recombinant protein, it is supplied in a storage buffer with pH 8.00, containing 0.3% glutathione and 0.79% Tris HCl as stabilizing agents. These buffer components help maintain the protein's native conformation during storage and experimental manipulation. For experimental protocols requiring different buffer conditions, researchers should minimize the time the protein spends in non-optimal buffers and verify activity after buffer exchange. Appropriate positive controls should be included when assessing protein functionality after storage or buffer modifications. When designing experiments, researchers should account for the presence of any proprietary tags that might influence protein behavior or interaction studies.

What experimental techniques are most effective for manipulating and studying STX2 expression?

Lentiviral transduction represents an efficient approach for both knockdown and overexpression of STX2 in experimental cell models. For loss-of-function studies, shRNA constructs targeting STX2 delivered via lentiviral vectors have proven effective in significantly reducing STX2 expression at both mRNA and protein levels in trophoblast cell lines and primary human trophoblasts. Conversely, gain-of-function studies can be accomplished through lentiviral delivery of STX2-expressing constructs, with successful overexpression verified through qRT-PCR and western blot analysis. The efficacy of these genetic manipulations should be rigorously assessed before proceeding with functional studies, typically showing at least 70-80% knockdown or significant overexpression compared to control conditions. For protein localization studies, immunofluorescence microscopy with appropriate antibodies can effectively visualize STX2's distribution between the cytomembrane and cytoplasm, providing valuable insights into its functional compartmentalization. Co-immunoprecipitation and GST pull-down assays represent powerful approaches for investigating STX2's protein-protein interactions, as demonstrated by studies revealing its direct binding to the p85 regulatory subunit of PI3K.

What functional assays are recommended for evaluating STX2's effects on cellular processes?

Several well-established functional assays effectively measure STX2's impact on key cellular processes. Cell proliferation can be quantified through multiple complementary approaches: EdU incorporation assays directly measure DNA synthesis, colony formation assays assess long-term proliferative capacity, CCK-8 assays monitor metabolic activity, and Ki67 immunostaining identifies actively dividing cells. For migration and invasion capabilities, transwell assays represent the gold standard, with or without Matrigel coating to distinguish between these two processes. Studies have shown that STX2 knockdown significantly reduces trophoblast proliferation, migration, and invasion, while STX2 overexpression enhances these processes, highlighting its functional importance in cellular behavior. To investigate STX2's role in signaling pathway activation, western blot analysis of phosphorylated pathway components (such as p-AKT at Ser473 and p-GSK3β at Ser9) following STX2 manipulation provides direct evidence of its regulatory effects. The impact of these signaling changes on downstream targets like β-catenin should also be assessed. For mechanistic studies involving specific pathway inhibition, pharmacological agents such as the PI3K inhibitor LY294002 can be employed to confirm the dependence of STX2-mediated effects on particular signaling cascades.

How can protein-protein interactions of STX2 be effectively investigated?

Investigation of STX2's protein-protein interactions requires a multi-technique approach to establish physiologically relevant binding partners. Co-immunoprecipitation (Co-IP) represents a primary method for identifying potential interaction partners in cellular contexts. Cell lysates can be immunoprecipitated with anti-STX2 antibodies, followed by western blot analysis with antibodies against suspected binding partners. This approach successfully identified interactions between STX2 and the p85 regulatory subunit of PI3K, while showing minimal binding to p110α and p110β catalytic subunits. To confirm direct physical interactions, GST pull-down assays provide compelling evidence through in vitro binding studies. Recombinant GST-tagged STX2 can be incubated with candidate partner proteins to assess direct binding, as demonstrated with the p85 subunit. Confocal microscopy with dual immunofluorescence labeling offers spatial information about interaction contexts, revealing co-localization patterns. In STX2 research, this technique confirmed STX2 and p85 co-localization at the cytomembrane and cytoplasm in control cells, with altered distribution patterns in STX2-knockdown cells. For functional validation of identified interactions, membrane protein fractionation followed by western blot analysis can determine whether STX2 influences the membrane recruitment of binding partners, as shown with decreased membrane localization of p85 in STX2-depleted cells.

What is the relationship between STX2 and preeclampsia pathogenesis?

STX2 expression appears significantly downregulated in placental tissues from women with preeclampsia (PE) compared to those from normal pregnancies, suggesting its potential involvement in disease pathogenesis. This decreased expression correlates with the abnormal trophoblast behaviors that characteristically contribute to PE development, including reduced proliferation, migration, and invasion capabilities. The functional significance of this association has been experimentally validated through both loss and gain of function studies, demonstrating that STX2 knockdown reproduces the cellular phenotypes observed in preeclamptic placentas, while STX2 overexpression can rescue these deficits. Mechanistically, the reduced STX2 expression in PE appears to compromise PI3K-AKT signaling activation through decreased recruitment of the p85 regulatory subunit to the cell membrane, further supporting a causal relationship between STX2 downregulation and disease progression. Studies have also revealed a positive correlation between STX2 protein expression and phosphorylated AKT levels in placental tissues from PE patients, reinforcing the clinical relevance of this regulatory axis. These findings collectively suggest that diminished STX2 function may represent a novel pathological mechanism contributing to PE development, rather than merely serving as a secondary consequence of the disease process.

How does STX2 regulate trophoblast proliferation, migration, and invasion?

STX2 exhibits potent regulatory effects on trophoblast cell behaviors essential for normal placental development. In both HTR-8/SVneo trophoblast cell lines and primary human trophoblast cells, STX2 knockdown significantly reduces cell proliferation as measured by EdU incorporation and colony formation assays. Conversely, STX2 overexpression substantially enhances trophoblast proliferative capacity compared to control conditions. Similar effects are observed with migration and invasion capabilities, as assessed through transwell assays, with STX2 depletion markedly inhibiting these processes while STX2 overexpression promotes them. Mechanistically, these effects appear mediated through STX2's activation of the PI3K-AKT signaling pathway, as evidenced by experiments showing that STX2 knockdown reduces phosphorylation of AKT at Ser473 and its downstream target GSK3β at Ser9, with corresponding decreases in β-catenin levels. The direct interaction between STX2 and the p85 regulatory subunit of PI3K facilitates AKT activation by recruiting PI3K to the cell membrane, where it can generate PIP3 to initiate signaling cascades regulating cellular behaviors. The specificity of this mechanism is confirmed by observations that pharmacological inhibition of PI3K using LY294002 abolishes STX2-mediated enhancement of trophoblast functions, establishing a causal relationship between STX2's effects and PI3K-AKT pathway activation.

What experimental evidence supports STX2 as a potential therapeutic target in preeclampsia?

Multiple lines of experimental evidence support STX2's potential as a therapeutic target in preeclampsia management. First, the consistent downregulation of STX2 in placental tissues from PE patients establishes its clinical relevance to the disease process. Functional studies demonstrate that STX2 overexpression can rescue the deficits in trophoblast proliferation, migration, and invasion that characterize PE pathophysiology, suggesting that interventions to restore STX2 levels or function might counteract disease progression. The elucidation of STX2's mechanism of action through PI3K-AKT pathway activation provides a defined molecular framework for therapeutic development, with potential approaches including direct STX2 augmentation or targeted activation of downstream signaling components. The specificity of this mechanism is validated by experiments showing that PI3K inhibition negates STX2-mediated functional benefits, confirming this signaling axis as the primary mediator of STX2's effects. Importantly, the positive correlation between STX2 expression and activated AKT levels in patient samples reinforces the translational relevance of these experimental findings. The identification of STX2's direct interaction with the p85 regulatory subunit of PI3K through co-immunoprecipitation, GST pull-down, and co-localization studies further defines a specific molecular target for therapeutic intervention. Collectively, these findings indicate that approaches to enhance STX2 expression or mimic its interaction with p85 could represent novel therapeutic strategies for PE, meriting further investigation in preclinical and eventually clinical studies.

How does STX2 mediate PI3K-AKT signaling activation in cellular contexts?

STX2 activates the PI3K-AKT signaling pathway through a direct protein interaction mechanism that facilitates membrane recruitment of critical signaling components. Immunofluorescence and biochemical studies reveal that STX2 primarily localizes to the cytomembrane and cytoplasm of trophoblast cells, positioning it appropriately for interaction with signaling molecules. Co-immunoprecipitation experiments demonstrate that STX2 selectively binds to the p85 regulatory subunit of PI3K, but exhibits minimal affinity for the p110α and p110β catalytic subunits. This interaction specificity was further confirmed through GST pull-down assays showing direct binding between STX2 and p85 in vitro. Confocal microscopy revealed that STX2 and p85 co-localize at the cytomembrane and cytoplasm in control cells, while in STX2-knockdown cells, this organized co-localization is disrupted with scattered distribution of both proteins throughout the cytoplasm. Membrane protein fractionation experiments further demonstrated that STX2 depletion significantly reduces p85 membrane localization, confirming STX2's role in recruiting PI3K to the membrane compartment. This membrane recruitment is functionally significant, as it positions PI3K to generate PIP3, which subsequently recruits and activates AKT through phosphorylation at Ser473. Western blot analyses confirm that STX2 knockdown reduces phosphorylation of both AKT and its downstream target GSK3β, while STX2 overexpression enhances activation of this signaling cascade. The essential role of this pathway in mediating STX2's cellular effects is established through experiments using the PI3K inhibitor LY294002, which abolished STX2-mediated functional enhancements in trophoblast cells.

What structural features of STX2 are essential for its functional interactions?

STX2 contains several structural domains critical for its diverse cellular functions. The protein belongs to the syntaxin family and contains a characteristic t-SNARE coiled-coil homology domain that mediates protein-protein interactions involved in membrane fusion events. This structural feature is likely essential for STX2's role in vesicular transport and may contribute to its ability to interact with membrane-associated signaling complexes. The full-length protein consists of 287 amino acids with distinct regions mediating different aspects of its functionality. Although the specific structural elements responsible for STX2's interaction with the p85 subunit of PI3K have not been fully characterized, the observed membrane localization of STX2 suggests potential involvement of hydrophobic or amphipathic regions that facilitate membrane association. The protein's C-terminal portion contains the sequence MFIIICVIVLLVILGIILATTLS, which exhibits hydrophobic characteristics typical of transmembrane domains, potentially anchoring STX2 at the cell membrane where it can recruit signaling partners like p85. Protein sequence analysis indicates homology with other syntaxin family members that function in SNARE-mediated membrane fusion, suggesting evolutionary conservation of functionally important domains. Further structural studies, including deletion mapping and point mutation analyses, would be valuable for precisely defining the interaction interfaces between STX2 and its binding partners such as p85, potentially enabling the development of specific peptide mimetics or small molecules targeting these interactions for therapeutic purposes.

What is known about the tissue-specific expression and regulation of STX2?

STX2 exhibits variable expression patterns across different tissues and physiological states, suggesting context-dependent regulation of its function. In normal placental tissues, STX2 shows robust expression, while significantly reduced levels are observed in placental samples from preeclampsia patients, indicating potential dysregulation in pathological conditions. This differential expression pattern may reflect altered transcriptional or post-transcriptional regulatory mechanisms operating in disease states. The gene encoding STX2 is located on chromosome 12q24 and produces multiple alternatively spliced transcript variants resulting in distinct protein isoforms (STX2A, STX2B, STX2C) that may exhibit tissue-specific expression patterns. These isoforms potentially serve specialized functions in different cellular contexts, though their relative contributions to tissue-specific STX2 activities remain incompletely characterized. STX2 function appears particularly important in epithelial tissues, where it regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis. In the context of placental development, STX2 expression patterns may be regulated by developmental cues and microenvironmental factors that influence trophoblast differentiation and function. Pathway analysis indicates that STX2 participates in multiple biological processes, including botulinum neurotoxicity, neuronal systems, proteolytic cleavage of SNARE complex proteins, and SNARE interactions in vesicular transport, suggesting diverse functional roles across different tissue types. The molecular mechanisms controlling STX2 expression in different contexts—including transcription factors, epigenetic regulators, and post-transcriptional processes—represent important areas for future investigation that could reveal new approaches for modulating STX2 levels in therapeutic applications.

What are the most promising research directions for STX2 in clinical applications?

The current evidence positions STX2 as a promising candidate for both diagnostic and therapeutic applications in preeclampsia management. Its consistent downregulation in preeclamptic placental tissues, coupled with its mechanistic role in trophoblast dysfunction through PI3K-AKT signaling impairment, suggests potential utility as a diagnostic biomarker for early disease detection. Future research should focus on developing sensitive assays for measuring STX2 levels in maternal blood or other accessible samples to evaluate its predictive value for preeclampsia risk assessment. From a therapeutic perspective, strategies to enhance STX2 expression or function in trophoblasts represent an innovative approach to addressing the underlying pathophysiology of preeclampsia. This could involve gene therapy approaches to restore STX2 expression, peptide mimetics that recapitulate STX2's interaction with p85, or small molecules that stabilize this interaction to promote PI3K-AKT pathway activation. The specificity of STX2's interaction with the p85 regulatory subunit of PI3K provides a defined molecular target for therapeutic development that could potentially avoid the broader effects of non-specific PI3K-AKT pathway modulators. Additionally, further investigation into STX2's roles in other physiological and pathological contexts beyond preeclampsia may reveal additional clinical applications across different medical specialties. The established experimental models and methodological approaches for studying STX2 function provide a solid foundation for translational research aimed at moving these potential applications from bench to bedside.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.