Recombinant Human T-cell immunomodulatory protein (ITFG1)

What is ITFG1 and what are its known functions?

ITFG1 (integrin alpha FG-GAP repeat containing 1) is a transmembrane protein that functions as a modulator of T-cell function with protective effects in graft versus host disease models . Research indicates it plays crucial roles in:

• Cell adhesion and migration processes

• Maintaining tissue integrity during collective cell migration

• Potentially influencing cell cycle regulation, mitochondrial translation initiation, and DNA repair

The protein has been studied using various experimental models including MDA-MB-231 breast cancer cells, where it localizes primarily to the plasma membrane, consistent with its proposed role in cell adhesion .

What are the alternative names and identifiers for ITFG1?

ITFG1 appears in scientific literature under multiple designations:

• T-cell immunomodulatory protein (TIP)

• Linkin or LNKN-1

• CDA08 or CDA08-like protein

• Protein TIP

• Integrin alpha FG-GAP repeat-containing protein 1

In mouse models, it may be referred to as 2310047C21Rik, AI314457, or D8Wsu49e. The human protein is identified by UniProt accession number Q8TB96 .

Where is ITFG1 localized within cells?

Experimental evidence from MDA-MB-231 breast cancer cells demonstrates that ITFG1 primarily localizes to the plasma membrane, as confirmed through:

• Subcellular fractionation showing ITFG1 protein predominantly in the membrane fraction

• Immunostaining with anti-ITFG1 antibodies detecting the protein on the plasma membrane

• Flow cytometry confirming cell surface expression

This membrane localization is maintained regardless of whether the protein contains a C-terminal Myc tag, indicating that tagging does not affect its subcellular distribution .

How can recombinant ITFG1 be used in validation experiments?

Recombinant ITFG1 fragments serve as valuable tools for antibody validation:

• For blocking experiments with corresponding antibodies (e.g., PA5-53328), use the recombinant protein control fragment (Human ITFG1 aa 284-423)

• Employ a 100x molar excess of the protein fragment based on concentration and molecular weight

• Pre-incubate the antibody-protein control fragment mixture for 30 minutes at room temperature before application in IHC/ICC or Western blot experiments

This methodology confirms antibody specificity by demonstrating that pre-incubation with the target antigen prevents antibody binding in subsequent assays.

What techniques are most effective for detecting ITFG1 expression and localization?

Multiple complementary approaches have been successfully employed:

For optimal results, researchers should employ multiple methods to validate findings, as demonstrated in studies of ITFG1 in MDA-MB-231 cells .

How can protein interactions of ITFG1 be identified and validated?

A multi-layered approach provides robust identification of ITFG1 interactors:

• Initial identification:

  • Immunoprecipitation coupled with mass spectrometry (IP-MS) using epitope-tagged ITFG1

  • Quantitative comparison with control samples (typically log2 fold change > 0.6 or > 2)

  • Analysis of both transient and stable expression systems

• Validation strategies:

  • Co-immunoprecipitation followed by immunoblotting (as demonstrated with ITFG1-RUVBL1)

  • Reciprocal Co-IP experiments

  • Orthologous gene studies in model organisms like C. elegans

Using this methodology, researchers identified 180 proteins consistently associated with ITFG1 across multiple experimental conditions, providing high confidence in these interactions .

What is known about ITFG1's role in cancer progression?

Current research suggests ITFG1 involvement in cancer biology, particularly breast cancer:

• ITFG1-RUVBL1 interaction:

  • Validated in breast cancer cell line models

  • Implicated in metastatic processes

• Pathway associations:

  • Proteomic analysis reveals ITFG1 interactors enriched in cell cycle regulation and DNA repair pathways

  • These pathways are frequently dysregulated in cancer progression

• Cell migration implications:

  • ITFG1's role in maintaining tissue integrity during collective cell migration may directly impact invasive and metastatic potential of cancer cells

These findings suggest ITFG1 may influence multiple aspects of cancer biology through its interactions with key cellular proteins and pathways.

How does ITFG1 contribute to tissue integrity during collective cell migration?

Studies using C. elegans as a model organism have revealed that:

• Loss-of-function of lnkn-1 (the C. elegans ortholog of ITFG1) results in migratory detachment phenotypes

• Similar phenotypes occur when orthologs of ITFG1-interacting proteins (ATP9A/tat-5, NME1/ndk-1, and ANAPC2/apc-2) are disrupted

This suggests ITFG1 functions within a protein network that includes cohesion and condensin components to maintain cellular connections during migration processes . The consistent phenotypes across multiple gene disruptions indicate these interactions are functionally significant rather than merely physical associations.

What signaling pathways are influenced by ITFG1 and its interactors?

Gene ontology analysis of the 180 proteins consistently associated with ITFG1 reveals enrichment in several key cellular processes:

These diverse pathways highlight ITFG1's potentially multifaceted roles in cellular homeostasis and response to external stimuli, warranting further investigation into specific mechanisms.

How do environmental chemicals affect ITFG1 expression?

Gene-chemical interaction studies in rat models reveal ITFG1 expression sensitivity to various exposures:

These findings suggest ITFG1 expression and regulation may be environmentally responsive, with potential implications for immunological function under different exposure conditions .

What are the translational implications of ITFG1 research for immunotherapy?

ITFG1's dual roles in T-cell function and cellular adhesion suggest several therapeutic applications:

• Graft versus host disease management:

  • ITFG1's protective effects in GVHD models indicate potential for therapeutic modulation

  • Understanding mechanistic details could lead to targeted interventions

• Cancer immunotherapy:

  • The interaction between immune modulation and cancer cell behavior presents unique therapeutic opportunities

  • ITFG1's role in breast cancer cell models suggests potential influence on both tumor immunity and metastatic potential

• Biomarker development:

  • Chemical-induced changes in ITFG1 expression or methylation could serve as biomarkers for environmental exposures

  • Expression patterns might predict immune responses or cancer progression

Recombinant ITFG1 fragments, such as the commercially available Human ITFG1 (aa 284-423) control fragment, provide valuable tools for developing and validating these potential therapeutic approaches .

What are the key structural domains of ITFG1 and their functional significance?

The human ITFG1 protein contains distinctive structural elements:

• Integrin alpha FG-GAP repeats:

  • Structural motifs typically found in proteins involved in cell adhesion

  • Form a 7-bladed beta-propeller structure characteristic of integrin alpha chains

• Amino acid sequence of the recombinant fragment (aa 284-423):

  • NCQKSTIYLVRSGMKQWVPVLQDFSNKGTLWGFVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVILKNTSGSNQQAFLLENVPCNNASCEEARRMFKVYWELTDLNQIKDAMVATFFDIYEDGILDIVVLSKGYTKND

  • Contains regions important for antibody recognition and potentially for protein-protein interactions

These structural features support ITFG1's proposed roles in mediating cellular adhesion and signaling through specific protein-protein interactions at the cell surface.

What model systems are most appropriate for studying ITFG1 function?

Research indicates several effective model systems for ITFG1 investigations:

Selection should be based on specific research questions, with consideration of endogenous expression levels and the cellular processes under investigation.

What are the critical knowledge gaps in understanding ITFG1 function?

Despite progress in ITFG1 research, several important questions remain unanswered:

• Precise mechanisms of T-cell immunomodulation:

  • How does ITFG1 exert its protective effects in graft versus host disease?

  • Which signaling pathways are directly affected by ITFG1 in immune cells?

• Structure-function relationships:

  • Which domains are essential for specific protein interactions?

  • How does membrane localization contribute to ITFG1's diverse functions?

• Role in disease processes:

  • Is ITFG1 dysregulation a driver or consequence of cancer progression?

  • Could ITFG1 serve as a therapeutic target in immune-related disorders?