Recombinant Human T-cell leukemia virus 1 Accessory protein p12I

Shipped with Ice Packs
In Stock

Description

Functional Roles in Viral Pathogenesis and T-cell Activation

Key Mechanisms:

2.1 T-cell Activation
p12I enhances T-cell activation by:

  • Elevating cytoplasmic calcium: Triggers NFAT-dependent transcription of pro-inflammatory cytokines (e.g., IL-2) .

  • Modulating IL-2 signaling: Binds IL-2 receptor β/γ chains, potentiating Stat5 activation .

  • Upregulating p300: Increases expression of this transcriptional coactivator, amplifying HTLV-1-mediated T-cell proliferation .

Immune Evasion

Target MoleculeEffect of p12I ExpressionMechanismSource
MHC-IDownregulation (70% reduction)Binds nascent MHC-I-HC, directing proteasomal degradation
ICAM-1/ICAM-2Reduced surface expressionSelective trafficking interference
LFA-1 adhesionEnhanced clusteringFacilitates viral spread via T-T cell contact

Viral Replication

  • Infection efficiency: Critical for infecting quiescent T cells by overcoming mitogen dependency .

  • Persistent infection: Ablation of p12I in HTLV-1 proviral clones reduces in vivo infectivity by ~90% .

Experimental Models and Research Findings

3.1 Lentiviral Vector Systems
Recombinant p12I is typically expressed via bicistronic lentiviruses co-expressing GFP for tracking . Key studies include:

ModelExperimental OutcomeSource
Jurkat T cellsDose-dependent p300 upregulation; IL-2 ↑ by 2-3x
Primary CD4⁺ T cellsMHC-I MFI ↓ from 710 to 79; ICAM-1 ↓ (141→92)
PBMCsIL-2 production ↑ under phorbol ester stimulation

Truncation Mutagenesis

Truncation RegionNFAT ActivationMechanismSource
aa 33-47PositiveSH3-binding domain (PXXP motif)
aa 87-99PositiveSecond SH3-binding domain
aa 1-14NegativeER localization dependency
aa 70-86NegativeSuppression of NFAT activation

Molecular Interactions and Signaling Pathways

4.1 Calcium-Dependent Pathways
p12I induces calcium flux by:

  1. ER localization: Associates with calreticulin, disrupting calcium storage .

  2. NFAT activation: Calcium/calmodulin-dependent phosphorylation drives nuclear translocation of NFAT, upregulating IL-2 and other cytokines .

4.2 Synergy with Tax1
While p12I downregulates ICAM-1/2, Tax1 (another HTLV-1 protein) upregulates ICAM-1, suggesting counteracting roles in adhesion molecule modulation .

Implications for HTLV-1 Pathogenesis and Therapeutic Targeting

5.1 Role in ATLL Development
p12I’s ability to:

  • Enhance T-cell proliferation: Creates a permissive environment for viral replication .

  • Elicit immune tolerance: MHC-I/ICAM downregulation evades CTL and NK cell responses .

Potential Therapeutic Strategies

ApproachRationaleStatus
Calcium chelatorsInhibit NFAT activationPreclinical
MHC-I stabilizersRestore antigen presentationHypothetical
SH3-binding inhibitorsBlock p12I-protein interactionsExperimental

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are discouraged. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We strive to accommodate specific tag type requests. Please inform us of your desired tag, and we will prioritize its implementation during production.
Synonyms
Accessory protein p12I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) (HTLV-1)
Target Protein Sequence
MLFRLLSPLSPLALTALLLFLLPPSDVSGLLLRPPPAPCLLLFLPFQILSGLLFLLFLPL FFSLPLLLSPSLPITMRFPARWRFLPWKAPSQPAAAFLF
Uniprot No.

Target Background

Function
p12I, an accessory protein of the T-cell leukemia virus 1 (HTLV-1), functions as a modulator of T-lymphocyte proliferation and immune function. It may contribute to establishing a persistent infection. p12I binds and down-regulates the cell surface expression of interleukin-2 receptors (IL2RB and IL2RG). Additionally, it down-regulates cell surface MHC-I molecules by interacting with free, immature MHC-I heavy chains in the endoplasmic reticulum (ER) and targeting them to the proteasome for degradation. The interaction of p12I with IL2RB facilitates the recruitment of JAK1 and JAK3. This interaction subsequently leads to increased DNA-binding and transcriptional activity of STAT5.
Protein Families
HTLV-1 accessory protein p12I family
Subcellular Location
[Isoform p12I]: Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus, host cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and cellular localization of HTLV-1 p12I?

HTLV-1 p12I is a hydrophobic protein encoded by open reading frame I (ORF I) in the pX region of the HTLV-1 genome. The protein localizes primarily to cellular endomembranes, specifically within the endoplasmic reticulum. Its structure includes four SH3-binding motifs (PXXP) that facilitate protein-protein interactions. The protein contains cleavage sites that allow processing into p8, a smaller protein with distinct functions. The hydrophobic nature of p12I is critical for its membrane association and subsequent function in intracellular signaling pathways .

What are the primary molecular interactions of p12I with host cellular components?

p12I interacts with several key cellular components: (1) It binds to interleukin-2 (IL-2) receptor β and γ chains, suggesting involvement in IL-2 signaling pathways; (2) It associates with the H+ vacuolar ATPase, potentially affecting protein trafficking and cellular pH regulation; (3) It increases intracellular calcium levels, which activates nuclear factor of activated T cells (NFAT) signaling; (4) It enhances expression of p300, a crucial transcriptional coactivator in T cells; and (5) It down-modulates ICAM-1 and ICAM-2 expression, potentially reducing natural killer (NK) cell-mediated killing of infected cells .

How does p12I contribute to the HTLV-1 viral lifecycle?

p12I plays essential roles in establishing persistent HTLV-1 infection, particularly during early infection stages. Its primary contributions include: (1) Facilitating viral infectivity in quiescent T lymphocytes through calcium-dependent signaling; (2) Promoting T-cell activation, which is necessary for efficient retroviral integration and replication; (3) Enabling productive infection of monocytes, which may serve as viral reservoirs; and (4) Providing mechanisms for immune evasion through modulation of cell surface receptors. Notably, while p12I appears dispensable for in vitro infection of activated T cells, it is crucial for establishing persistent infection in vivo and for infecting resting primary lymphocytes in the absence of exogenous stimulation .

What is the relationship between p12I cleavage to p8 and HTLV-1 viral persistence?

The precursor protein p12I undergoes cleavage to produce p8, with genetic polymorphisms affecting cleavage efficiency. Research has identified three primary phenotypes based on p12I/p8 expression patterns: (1) Balanced expression of p12I and p8, associated with high viral DNA loads and disease development; (2) Predominant p12I expression, linked to reduced monocyte infection and lower viral DNA levels; and (3) Predominant p8 expression, which retains monocyte infection capability but is associated with lower viral DNA levels in infected individuals. Experimental evidence using infectious molecular clones with different p12I/p8 expression profiles has demonstrated that balanced expression is optimal for viral persistence in animal models. Specifically, clones expressing predominantly p12I (G29S) or p8 (N26) showed poor infectivity in macaques, whereas the clone with balanced expression (D26) established persistent infection in 3 of 4 animals .

How does p12I contribute to immune evasion mechanisms of HTLV-1?

p12I employs multiple strategies to facilitate immune evasion: (1) When expressed in balanced proportion with p8, it confers resistance to cytotoxic T lymphocyte (CTL) killing, as demonstrated by resistance of cells infected with D26 virus (balanced p12I/p8) to Tax-specific HLA.A2-restricted CTL killing; (2) It down-modulates ICAM-1 and ICAM-2, potentially reducing NK cell-mediated cytotoxicity; (3) It alters the expression of immune recognition molecules on infected cells; and (4) It may modify intracellular signaling pathways to prevent effective immune surveillance. These mechanisms collectively contribute to HTLV-1 persistence despite host immune responses. Notably, cells infected with viruses expressing predominantly p12I (G29S) or p8 (N26) remain susceptible to CTL killing, highlighting the necessity of balanced expression for effective immune evasion .

What experimental evidence demonstrates the necessity of p12I for in vivo viral persistence?

Multiple experimental approaches have established p12I's essential role in viral persistence: (1) In rabbit models, HTLV-1 clones with selective ablation of p12I (ACH.p12I) failed to establish persistent infection, as evidenced by reduced anti-HTLV-1 antibody responses, absence of p19 antigen production in PBMC cultures, and only transient detection of proviral DNA; (2) In rhesus macaque studies, viruses expressing predominantly p12I or p8 showed significantly reduced ability to establish infection compared to viruses with balanced expression; (3) In coculture assays with quiescent human PBMCs, p12I-deficient viruses demonstrated dramatically reduced infectivity; and (4) Epidemiological studies in humans revealed associations between p12I/p8 expression patterns and viral loads. Importantly, addition of IL-2 and phytohemagglutinin during infection rescued the ability of p12I-deficient viruses to infect primary lymphocytes, confirming p12I's role in facilitating infection of unstimulated cells .

What are the most effective experimental models for studying p12I functions?

Several experimental systems have proven valuable for investigating p12I functions: (1) Infectious molecular clones: The ACH clone and derivatives (ACH.p12I, D26, G29S, N26) with specific modifications in p12I expression provide critical tools for functional studies; (2) Animal models: Rabbit and rhesus macaque models offer in vivo systems to assess viral persistence and immune responses; (3) Primary cell cultures: Quiescent peripheral blood mononuclear cells (PBMCs) without exogenous stimulation provide physiologically relevant systems that better reflect in vivo conditions than activated cell lines; (4) Monocyte infection models: THP-1 cells and primary monocytes allow investigation of p12I's role in non-T cell infection; and (5) Recombinant lentiviral vectors expressing p12I: These enable analysis of p12I's effects on cellular gene expression independent of other viral components. Importantly, standard in vitro systems using activated cell lines often fail to demonstrate p12I's contribution to viral infectivity, highlighting the necessity of using quiescent primary cells to accurately model in vivo infection dynamics .

What methodologies can detect and quantify p12I and p8 expression in experimental systems?

Detecting and quantifying p12I and p8 present technical challenges due to their low expression levels. Effective approaches include: (1) RT-PCR analysis to measure mRNA expression from ORF I; (2) Immunoblotting with specific antibodies against p12I and p8, though sensitivity may be limited; (3) Recombinant expression systems with epitope tags to facilitate detection; (4) Flow cytometry for analyzing p12I's effects on cell surface receptors and activation markers; (5) Calcium imaging to assess p12I-mediated calcium flux; and (6) Gene array analysis to measure p12I-induced changes in host gene expression. For distinguishing between p12I and p8, researchers can utilize mutations at cleavage sites (such as G29S) that alter processing efficiency, combined with size-based separation methods. Additionally, functional assays measuring T cell activation markers, viral infectivity in quiescent cells, and CTL susceptibility can serve as indirect measures of p12I/p8 activity .

How do polymorphisms in ORF I correlate with viral loads and disease progression?

Analysis of ORF I sequences from 160 HTLV-1-infected individuals revealed significant associations between genetic polymorphisms, p12I/p8 expression patterns, and clinical parameters. The data showed three distinct groups based on protein expression: (1) Balanced p12I/p8 expression: Associated with significantly higher viral DNA loads, a known correlate of disease development. This group showed effective monocyte infection and resistance to CTL killing; (2) Predominant p12I expression: Correlated with lower viral DNA levels and reduced ability to productively infect monocytes; (3) Predominant p8 expression: The rarest phenotype, maintained monocyte infection capability but was associated with lower viral DNA levels. These correlations suggest that the ratio between p12I and p8 significantly influences viral persistence and potentially disease progression. The finding that balanced expression correlates with higher viral loads provides a potential mechanism for identifying individuals at increased risk for HTLV-1-associated diseases .

What calcium-dependent signaling pathways are modulated by p12I, and how do they affect viral replication?

p12I modulates multiple calcium-dependent signaling pathways that collectively support viral replication: (1) It increases intracellular calcium levels, activating nuclear factor of activated T cells (NFAT), a critical transcription factor for T cell activation; (2) Gene array analysis revealed that p12I expression alters cellular genes predominantly in a calcium-dependent manner, affecting pathways involved in cell proliferation and signaling; (3) It enhances expression of p300, a rate-limiting transcriptional coactivator important in HTLV-1 pathogenesis; (4) Calcium-dependent activation leads to upregulation of T cell activation markers, creating a cellular environment conducive to viral integration and replication; and (5) These calcium-mediated effects may explain how p12I facilitates infection of quiescent T lymphocytes without external stimulation. The critical role of calcium signaling is further evidenced by the observation that providing external T cell activation signals through IL-2 and phytohemagglutinin can rescue the infectivity defect of p12I-deficient viruses .

What are the potential therapeutic implications of targeting p12I processing or function?

Research on p12I suggests several promising therapeutic strategies: (1) Developing inhibitors targeting the cleavage of p12I to p8, which could disrupt the balanced expression required for optimal viral persistence; (2) Designing compounds that interfere with p12I's calcium-mobilizing activities, potentially preventing T cell activation necessary for viral replication; (3) Targeting interactions between p12I and host proteins such as IL-2 receptor chains or p300; (4) Developing approaches to restore CTL recognition of HTLV-1-infected cells expressing balanced p12I/p8 levels; and (5) Combination therapies addressing both p12I functions and other viral targets. The observation that pharmacologically altering the efficiency of p12I cleavage could have profound effects on viral persistence by restoring host immune responses suggests a novel approach to controlling HTLV-1 infection. Such strategies could potentially reduce viral loads and ultimately decrease the risk of HTLV-1-associated disease development .

How does p12I compare functionally with accessory proteins from other complex retroviruses?

HTLV-1 p12I shares functional similarities with accessory proteins from other complex retroviruses, but also possesses unique characteristics: (1) Like HIV-1 Nef, p12I modulates cell surface expression of immune recognition molecules, though through distinct mechanisms; (2) Similar to HIV-1 Vpu, p12I localizes to endomembranes and affects protein trafficking; (3) Unlike many other accessory proteins that directly antagonize specific restriction factors, p12I appears to create a generally favorable cellular environment for viral replication through calcium signaling and T cell activation; (4) p12I's ability to form distinct functional products (p12I and p8) from a single precursor represents a relatively unique strategy for expanding protein functionality within the constraints of a compact viral genome; and (5) While many viral accessory proteins are individually dispensable in vitro but essential in vivo, p12I is distinctive in its specific requirement for infection of quiescent, but not activated, T cells. These comparisons highlight both conserved strategies across complex retroviruses and unique adaptations specific to HTLV-1's lifecycle and persistence mechanisms .

What other HTLV-1 accessory proteins interact with p12I, and how do these interactions affect viral function?

HTLV-1 encodes several accessory proteins besides p12I, including p27I, p13II, and p30II in the pX region, and emerging evidence suggests functional interplay between these proteins: (1) While direct physical interactions between p12I and other HTLV-1 accessory proteins have not been definitively established, functional interdependence has been observed; (2) Studies on p13II and Tax have demonstrated significant interplay between viral proteins, suggesting similar relationships may exist with p12I; (3) The balanced functions of multiple accessory proteins likely contribute to creating an optimal cellular environment for viral persistence; (4) Complementary roles in immune evasion may exist, with different accessory proteins targeting distinct aspects of innate and adaptive immunity; and (5) Genetic studies suggest that mutations in other viral genes can potentially impact the function of ORF I products. These complex interactions highlight the sophisticated strategies employed by HTLV-1 to establish persistent infection and underscore the importance of studying viral proteins not in isolation but as components of an integrated system .

What are the major technical challenges in studying p12I, and how might they be overcome?

Research on p12I faces several significant challenges: (1) Low expression levels in infected cells make detection difficult without overexpression systems that may alter function; (2) The hydrophobic nature of p12I creates technical difficulties in protein purification and structural studies; (3) Distinguishing between effects of p12I and its cleavage product p8 requires specialized reagents and approaches; (4) Standard in vitro culture systems using activated cells mask p12I's importance, necessitating more physiologically relevant models; and (5) The complexity of calcium signaling pathways makes it challenging to isolate specific p12I-mediated effects. To overcome these challenges, researchers can: (a) Develop more sensitive detection methods including nano-immunoassays; (b) Utilize advanced imaging techniques to track p12I trafficking in living cells; (c) Create better animal models that recapitulate human T cell dynamics; (d) Apply systems biology approaches to understand complex signaling networks; and (e) Develop improved in vitro models using primary human cells maintained in conditions more closely resembling the in vivo environment .

What unresolved questions about p12I function warrant further investigation?

Despite significant advances, several key questions about p12I remain unanswered: (1) What is the three-dimensional structure of p12I, and how does cleavage affect protein conformation and function? (2) What host proteases are responsible for p12I cleavage, and how is this process regulated during infection? (3) How does the balance between p12I and p8 change during different stages of infection and disease progression? (4) What is the precise mechanism by which p12I/p8 balance affects CTL recognition of infected cells? (5) Do p12I and p8 have distinct roles in different infected cell types, particularly in non-T cells such as monocytes? (6) How does p12I contribute to HTLV-1 pathogenesis beyond establishing initial infection? (7) What is the role of infected monocytes in HTLV-1 persistence and pathogenesis? (8) Can targeting p12I processing or function lead to clinical benefits in HTLV-1-associated diseases? Addressing these questions will require interdisciplinary approaches combining structural biology, advanced imaging, primary cell models, and clinical studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.