Recombinant Human T-cell receptor delta chain C region (TRDC)

Shipped with Ice Packs
In Stock

Description

Genomic Organization and Diversity

The human TRD locus exhibits unique genomic features that contribute to receptor diversity:

Genomic ComponentDetailsSource
LocationChromosome 14q11.2, upstream of TEA (T early alpha)
Gene segments3 Dδ (diversity), 2 Jδ (joining), and 1 Cδ (constant) segments
RearrangementDδ1-Dδ2 tandem recombination with Vδ and Jδ segments

Diversity arises from:

  • Exonuclease trimming: Modifies V-D-J junctions during recombination

  • N-region additions: Random nucleotide insertions at recombination junctions, enhancing combinatorial variability

  • Promiscuous Vδ usage: TRDV1 frequently recombines with TRAJ genes in αβ T cells, expanding functional diversity

Research Applications

Recombinant TRDC is widely used in immunological studies:

Key Applications

ApplicationExperimental ModelOutcomeSource
ELISA/Western blotHuman T-cell linesConfirms TRDC expression in γδ TR complexes
IFNγ ELISpot assayTRDC-transduced T cellsInduces tumor cell recognition (HLA-independent)
Flow cytometryJurkat cells (JΔE10)Validates surface TR-CD3 complex formation

Functional Insights

  • Tumor reactivity: TRDV1-TRAJ24 TRDC-containing receptors trigger robust IFNγ responses against HLA-negative tumors .

  • CD3 colocalization: TRDC expression restores CD3 surface presentation in TCR-deficient cells .

Comparative Genomic Analysis

TRDC’s locus organization is conserved across mammals but exhibits species-specific recombination patterns:

FeatureHumanMouse
Vδ utilizationDominant TRDV1TRDV2-2 common in TRA chains
Jδ frequencyPreferential Jδ1 usageBroader Jδ distribution
Dδ segmentsDδ1 (9 bp), Dδ2 (13 bp)Single Dδ segment

Clinical and Mechanistic Implications

  • Innate-like immunity: TRDC-linked γδ TRs enable rapid responses to epithelial pathogens .

  • Therapeutic potential: Engineered TRDC-containing receptors show promise in tumor immunotherapy .

  • Allelic exclusion: The TRD locus undergoes strict allelic exclusion to ensure mono-specificity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TRDC; T cell receptor delta constant
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TRDC
Target Protein Sequence
SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKL GKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTE KVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL
Uniprot No.

Target Background

Function

The constant region of the T cell receptor (TR) delta chain participates in antigen recognition. Gamma-delta TRs recognize a diverse range of self and foreign non-peptide antigens, often expressed at epithelial boundaries. These antigens include endogenous lipids presented by the MHC-like protein CD1D and phosphoantigens presented by the butyrophilin-like molecule BTN3A1. Antigen recognition triggers rapid, innate-like immune responses crucial for pathogen clearance and tissue repair.

Binding of the gamma-delta TR complex to an antigen initiates phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) within the CD3 chains by LCK and FYN kinases. This leads to the recruitment, phosphorylation, and activation of ZAP70, facilitating the phosphorylation of scaffolding proteins LCP2 and LAT. Consequently, a supramolecular signalosome forms, recruiting phospholipase PLCG1, resulting in calcium mobilization and ERK activation, ultimately driving T cell expansion and differentiation into effector cells.

Gamma-delta TRs are generated through somatic rearrangement of a limited repertoire of variable (V), diversity (D), and joining (J) genes. Their diversity stems from the unique ability to rearrange (D) genes in tandem and utilize all three reading frames. Combinatorial diversity is further enhanced by exonuclease trimming and random nucleotide (N) region additions during V-(D)-J rearrangements.

Database Links

HGNC: 12253

OMIM: 186810

Subcellular Location
Cell membrane.

Q&A

What is the T-cell receptor delta chain C region and what is its role in immune function?

The T-cell receptor delta chain C region (TRDC) serves as the constant region of the T cell receptor delta chain that actively participates in antigen recognition processes within the immune system. This protein component is essential for gamma-delta T cell functionality, enabling these cells to recognize a variety of self and foreign non-peptide antigens frequently expressed at epithelial boundaries between the host and external environment. These recognized antigens include endogenous lipids presented by MH-like protein CD1D and phosphoantigens presented by butyrophilin-like molecule BTN3A1, which trigger immune responses critical for maintaining epithelial integrity. Upon recognition of these antigens, TRDC-containing receptors facilitate rapid, innate-like immune responses that play crucial roles in both pathogen clearance mechanisms and tissue repair processes, establishing TRDC as a fundamental component in the immune surveillance system's functionality and efficiency .

How are gamma-delta T cells containing TRDC different from conventional T cells?

Gamma-delta T cells containing TRDC differ from conventional alpha-beta T cells in several significant ways that impact their research applications and therapeutic potential. Unlike alpha-beta T cells that typically recognize peptide antigens presented by major histocompatibility complex (MHC) molecules, gamma-delta T cells can directly recognize non-peptide antigens without requiring MHC presentation, giving them unique functional capabilities in the immune response system. The antigen recognition triggers a distinctive signaling cascade where binding of the gamma-delta T cell receptor complex to antigens initiates phosphorylation of immunoreceptor tyrosine-based activation motifs in CD3 chains by the LCK and FYN kinases, allowing recruitment and activation of ZAP70 that facilitates phosphorylation of scaffolding proteins LCP2 and LAT. This distinctive signaling pathway leads to the formation of a supramolecular signalosome that recruits phospholipase PLCG1, resulting in calcium mobilization and ERK activation, ultimately driving T cell expansion and differentiation into specialized effector cells. Another major distinction lies in their genetic diversity mechanism, as gamma-delta T cell receptors are produced through somatic rearrangement of variable (V), diversity (D), and joining (J) genes, with the unique ability to rearrange D genes in tandem and utilize all three reading frames, creating a different pattern of combinatorial diversity than conventional T cells .

What are the reliable markers for identifying gamma-delta T cells in experimental settings?

The definitive identification of gamma-delta T cells in experimental settings requires a strategic combination of specific molecular markers to ensure accurate results and prevent misclassification. The T-cell receptor delta chain constant region (TRDC) serves as a canonical transcriptional marker for gamma-delta T cells, with research demonstrating that T cells lacking TRDC expression are less likely to be actual gamma-delta T cells and cannot be reliably classified as such based solely on RNA expression patterns. For comprehensive identification, particularly in single-cell RNA sequencing analysis, researchers should employ a combination of CD3D, CD3E, CD3G, CD247 (CD3Z), and TRDC as a reliable, minimal set of marker genes to distinguish gamma-delta T cells from other cell types in unsorted whole tissue samples. This marker combination is especially valuable because genuine gamma-delta T cells consistently express all four CD3 subunits at high levels, which distinguishes them from their lymphoid relatives like natural killer cells and innate lymphoid cells that may occasionally express cytoplasmic CD3s but typically only express parts of the CD3 complex at low levels. Additionally, the expression pattern of these markers aligns with flow cytometry results, providing consistent identification across different experimental platforms and techniques .

What are the methodological approaches for expressing recombinant TRDC protein for research applications?

The expression of recombinant T-cell receptor delta chain C region (TRDC) protein for research applications requires selecting appropriate expression systems based on the specific experimental requirements and downstream applications. Wheat germ expression systems have demonstrated effectiveness for producing functional recombinant human TCR proteins, including TRDC fragments, particularly for applications requiring proteins in the range of 173 to 272 amino acids. This plant-based expression system offers advantages for maintaining proper protein folding of complex mammalian proteins while avoiding potential toxicity issues encountered in bacterial systems. For quality control and validation, expressed recombinant TRDC proteins should undergo comprehensive functional testing to confirm their biological activity, including verification through Enzyme-Linked Immunosorbent Assay (ELISA) and Western Blotting (WB) techniques to assess protein expression, purity, and immunoreactivity. Researchers should establish stringent purification protocols to eliminate contaminants while preserving the structural integrity and functional domains of the recombinant TRDC protein, ensuring that the final product accurately represents the native protein's characteristics for reliable experimental outcomes and meaningful data interpretation .

How can researchers evaluate the functional activity of recombinant TRDC in vitro?

Evaluating the functional activity of recombinant T-cell receptor delta chain C region (TRDC) in vitro requires a comprehensive assessment strategy that examines multiple aspects of its biological activity. Researchers should initially perform binding assays to measure the interaction between the recombinant TRDC and its known ligands, such as non-peptide antigens, endogenous lipids presented by CD1D, or phosphoantigens presented by BTN3A1, using techniques like surface plasmon resonance or fluorescence-based binding assays to quantify binding affinity and kinetics. Signal transduction analysis represents another crucial approach, where researchers can assess the ability of the recombinant TRDC to initiate downstream signaling cascades by measuring the phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) in CD3 chains and subsequent activation of ZAP70, LCP2, and LAT proteins, typically through phospho-specific antibodies and Western blotting or flow cytometry techniques. Calcium mobilization assays using calcium-sensitive fluorescent dyes can directly evaluate whether the recombinant TRDC can trigger this essential component of T cell activation, providing real-time measurement of functional activity in cellular systems. Additionally, T cell proliferation and differentiation assays measure the ultimate biological outcome of TRDC function, where researchers can assess whether recombinant TRDC engagement leads to appropriate T cell expansion and differentiation into effector cells, confirming its ability to recapitulate the complete biological pathway observed in native systems .

How can single-cell RNA sequencing be optimized for accurate identification and characterization of TRDC-expressing cells?

Optimizing single-cell RNA sequencing (scRNA-seq) for accurate identification and characterization of TRDC-expressing cells requires implementing strategic methodological approaches throughout the experimental workflow. During pre-sequencing sample preparation, researchers should employ precise cell isolation strategies combining multiple markers, such as CD3+TCRγδ+TCRαβ-, while recognizing that flow cytometry gating alone may not be sufficient for definitive identification of gamma-delta T cells without additional verification. The bioinformatic analysis pipeline should incorporate a reliable multi-marker approach that consistently identifies gamma-delta T cells by simultaneously evaluating the expression of TRDC alongside all four CD3 complex components (CD3D, CD3E, CD3G, and CD247), as this combination provides superior discrimination between genuine gamma-delta T cells and other lymphoid cell types that may share partial marker expression. To enhance confidence in cell type identification, researchers should perform complementary T cell receptor sequencing (TCR-seq) paired with scRNA-seq, which allows direct confirmation of productive TCR delta chains in TRDC-expressing cells, distinguishing them from cells that might express TRDC transcript but lack functional gamma-delta TCR proteins. Additionally, computational validation through dimension reduction techniques and clustering algorithms should be applied to verify that identified TRDC-expressing cells form distinct populations with expected transcriptional profiles, using reference datasets and established gamma-delta T cell signatures to confirm accurate classification .

What role do TRDC-expressing gamma-delta T cells play in colorectal cancer microenvironments?

TRDC-expressing gamma-delta T cells play critical functional roles within colorectal cancer microenvironments that significantly impact tumor immunosurveillance and clinical outcomes. Comprehensive single-cell RNA sequencing analysis of human colorectal cancer tissues has revealed that tumor-infiltrating gamma-delta T cells exhibit notably high cytotoxicity-related transcriptional signatures in both tumor tissue and adjacent normal tissue, indicating their primary role as cytotoxic effector cells rather than immunosuppressive or pro-tumorigenic agents. This finding challenges previous concerns about potentially detrimental roles of these cells in cancer progression. The research has identified various functional subsets of gamma-delta T cells within the tumor microenvironment, including effector T cells (Teff), tissue-resident memory T cells (TRM), precursor exhausted T cells (Tpex), and exhausted T cells (Tex), each with distinct functional roles in anti-tumor immune responses. A particularly significant observation is the increased expression of cytotoxic molecules in tumor-infiltrating gamma-delta T cells compared to their counterparts in normal adjacent tissue, suggesting an enhanced anti-tumor potential that could be harnessed for therapeutic strategies. Contrary to earlier concerns derived primarily from murine models, human colorectal cancer gamma-delta T cells do not show IL-17 production potential, mitigating worries about their possible pro-tumorigenic roles and highlighting important cross-species discrepancies that must be considered when translating findings from animal models to human clinical applications .

What specialized research facilities are required for comprehensive TRDC research programs?

Comprehensive T-cell receptor delta chain C region (TRDC) research programs require specialized facilities and infrastructure to support the complex experimental workflows and sensitive analytical techniques essential for studying these immune components. Research data centers, such as those modeled after the Triangle Research Data Center (TRDC) with branches in multiple research institutions, provide crucial computational infrastructure for handling the massive datasets generated by modern TRDC research, particularly from high-throughput sequencing technologies and complex immunological analyses. These centers enable researchers to perform statistical analysis on non-public microdata through secure, compliant environments that maintain data integrity and confidentiality while facilitating collaborative research. Core facilities for TRDC protein production and characterization represent another essential component, equipped with specialized expression systems (such as wheat germ cell-free systems) that have demonstrated effectiveness for recombinant TCR protein production, along with dedicated purification equipment, quality control instrumentation, and storage infrastructure to maintain protein stability and activity. Advanced imaging facilities with confocal microscopy, super-resolution imaging, and potentially intravital microscopy capabilities are necessary for visualizing TRDC-expressing cell interactions in tissues and studying receptor dynamics during immune response processes, providing crucial spatial context to molecular analyses .

How can non-competitive research environments enhance TRDC educational programs for researchers?

Non-competitive research environments provide valuable educational opportunities for researchers studying T-cell receptor delta chain C region (TRDC) by fostering collaborative learning and skills development without the pressure of competition. Convention-style educational programs, modeled after successful formats like The Royal Dance Competition (TRDC) Conventions, can be adapted to create immersive learning experiences where TRDC researchers of various expertise levels learn additional techniques and methodological approaches from established professionals in the field. These programs should feature classes taught by experienced researchers and educators who bring both technical expertise and creative problem-solving approaches to TRDC research challenges, with opportunities for participants to engage in direct question-and-answer sessions with these experts to address specific methodological or conceptual questions. Structured according to participant experience levels, these educational programs can offer tailored content where early-career researchers receive focused instruction on fundamental TRDC research techniques, while more advanced participants engage with cutting-edge methodologies and complex experimental designs. A particularly valuable component would be "mock grant review" or "mock publication submission" exercises that simulate the professional research environment, allowing participants to learn about funding acquisition and publication strategies specific to TRDC research while receiving constructive feedback from experienced mentors in a supportive setting .

What statistical approaches are most appropriate for analyzing TRDC expression data from single-cell sequencing studies?

Analyzing T-cell receptor delta chain C region (TRDC) expression data from single-cell sequencing studies requires sophisticated statistical approaches tailored to the unique characteristics of these datasets and their biological context. Dimensionality reduction techniques, particularly t-distributed stochastic neighbor embedding (t-SNE) and uniform manifold approximation and projection (UMAP), serve as foundational analysis tools for visualizing high-dimensional TRDC expression data in lower-dimensional space, allowing researchers to identify distinct cell populations and relationships between TRDC-expressing cells and other immune cell types within the dataset. Specialized clustering algorithms, such as graph-based approaches like Louvain or Leiden algorithms, effectively group cells with similar transcriptional profiles, helping researchers identify distinct gamma-delta T cell subpopulations that may have different functional roles, states of activation, or tissue localization patterns based on their gene expression signatures beyond just TRDC levels. Differential expression analysis comparing TRDC-positive cells across experimental conditions, tissue types, or disease states enables the identification of genes and pathways that change in conjunction with TRDC expression, providing insights into the functional consequences of TRDC activity in different contexts. Additionally, trajectory inference methods analyze the developmental or activation trajectories of TRDC-expressing cells, reconstructing potential lineage relationships and state transitions, which is particularly valuable for understanding how gamma-delta T cells differentiate into various functional subtypes like the effector, tissue-resident memory, precursor exhausted, and exhausted subsets identified in colorectal cancer microenvironments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.