Recombinant Human T-cell surface glycoprotein CD3 delta chain (CD3D)

Shipped with Ice Packs
In Stock

Description

Molecular Weight and Oligomerization

ConditionMolecular Weight (kDa)Source
Reducing (SDS-PAGE)54–61 (monomer)R&D Systems
Non-reducing (SDS-PAGE)108–122 (dimer)R&D Systems
HEK293 expression18–25 (glycosylated)Abcam

Functional Role in T-Cell Biology

CD3D partners with CD3E, CD3G, and CD3Z to form the TCR-CD3 complex, which mediates:

  • T-cell activation: ITAM phosphorylation by LCK/FYN kinases triggers downstream signaling .

  • Thymocyte differentiation: Ensures proper TCR-CD3 assembly for T-cell maturation .

  • Coreceptor interaction: Binds CD4/CD8 to link TCR engagement with MHC molecules .

Pathological Implications

Defects in CD3D cause T-/B+/NK+ severe combined immunodeficiency (SCID), characterized by absent T cells, leukopenia, and impaired immunity .

Recombinant Production and Formats

Commercial CD3D proteins are expressed in mammalian systems (e.g., HEK293, Expi293) with high purity (>90%) and low endotoxin levels (<1 EU/µg) .

Common Constructs

ConstructTagApplications
CD3D-Fc ChimeraHuman IgG1 FcBinding assays, ELISA
CD3D/CD3E HeterodimerHis/Tag-FreeSPR, antibody validation
Biotinylated CD3D-Fc Avi-tagAvi-tagFlow cytometry, imaging

Binding Kinetics

  • CD3D-Fc binds CD3E-Fc with a 50% effective concentration (EC50) of 1.0–6.0 µg/mL in ELISA .

  • Anti-CD3 antibodies (e.g., OKT3) bind CD3E/CD3D heterodimers with affinity constants (KD) of 10.7–40 nM (SPR) .

Species Cross-Reactivity

SpeciesExtracellular Domain Homology
Cynomolgus monkey89%
Rat61%
Mouse57%
Data from R&D Systems

Applications in Biomedical Research

  • Therapeutic antibody development: Used to validate bispecific T-cell engagers (e.g., CD3×BCMA) with KD ≈37 nM .

  • Immunodeficiency studies: Models SCID mutations to explore TCR assembly defects .

  • Structural biology: Facilitates cryo-EM studies of TCR-CD3 complex architecture .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. If you require a specific tag, please inform us for preferential development.
Synonyms
CD3D; T3D; T-cell surface glycoprotein CD3 delta chain; T-cell receptor T3 delta chain; CD antigen CD3d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-171
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Uniprot No.

Target Background

Function
Recombinant Human T-cell surface glycoprotein CD3 delta chain (CD3D) is a component of the TCR-CD3 complex on T-lymphocytes, crucial for adaptive immune responses. Following activation of the T-cell receptor (TCR) by antigen-presenting cells (APCs), CD3 chains (CD3D, CD3E, CD3G, and CD3Z) transmit signals across the membrane. Each chain contains immunoreceptor tyrosine-based activation motifs (ITAMs) in its cytoplasmic domain, which are phosphorylated by LCK and FYN kinases upon TCR engagement. This initiates downstream signaling pathways. Beyond its role in T-cell activation, CD3D is essential for thymocyte differentiation, ensuring proper TCR-CD3 complex assembly and surface expression. Its absence impairs proper thymocyte differentiation. CD3D also interacts with CD4 and CD8, linking the TCR to these coreceptors, necessary for the activation and positive selection of CD4 or CD8 T-cells.
Gene References Into Functions
  1. CD3D and PKRCQ gene expression differentiates between B-cell and T-cell acute lymphoblastic leukemia (PMID: 27494091).
  2. A 2A self-processing peptide improves diabody chain expression (PMID: 28075428).
  3. An immunosuppressive FOXP3(+)CD3(+)CD56(+) T-cell population correlates with reduced survival in hepatocellular carcinoma (PMID: 26437631).
  4. The CD3 subunit docking site on the T-cell receptor beta chain has been identified by solution NMR (PMID: 26109064).
  5. Studies on the molecular organization of the TCR-CD3 complex (PMID: 25422432).
  6. SCID cases linked to CD3 delta gene mutations (PMID: 24288697).
  7. Comparison of TCR surface expression in CD3G and CD3D deficient T cells (PMID: 23336327).
  8. Altered expression of CD3 and FcepsilonRIgamma in aplastic anemia (PMID: 22401598).
  9. Accumulation of a gammadelta T cell subset in mouse ear keratinocytes (PMID: 21984702).
  10. SCID cases with a selective block in alphabeta T cell development and a new splicing mutation in CD3D (PMID: 21926461).
  11. Differences in CD3 chain expression patterns between multiple myeloma patients and healthy controls (PMID: 21669053).
  12. CD3 chain gene expression patterns in the placenta (PMID: 21669059).
  13. Enhanced efficacy of trastuzumab with phosphoantigen-stimulated gammadelta T-lymphocytes against HER-2-positive breast carcinoma (PMID: 21670311).
  14. Comparative analysis of CD3 delta and gamma subunit evolution (PMID: 20660709).
  15. Delayed and sustained intracellular calcium mobilization in Vgamma9Vdelta2 T cells (PMID: 20511557).
  16. Conformational changes in CD3 epsilon after dimerization (PMID: 12410792).
  17. SCID due to CD3 delta deficiency (PMID: 14602880).
  18. Crystal structure of CD3 epsilon/delta ectodomain complex (PMID: 15534202).
  19. SCID caused by CD3D deficiency (PMID: 15546002).
  20. Role of a YxxO motif in CD3 delta internalization (PMID: 15778375).
  21. Restoration of preTCR function in CD3-deficient mice using a human CD3 transgene (PMID: 16412509).
  22. Differential roles of CD3 delta and gamma in human and mouse T-cell development (PMID: 16888097).
  23. Analysis of TCRalpha-CD3deltaepsilon and TCRbeta-CD3gammaepsilon dimers (PMID: 17023417).
  24. CD3 delta cytoplasmic domain binding to phospholipid vesicles (PMID: 17176095).
  25. CD3 gamma substitution by CD3 delta in CD3 gamma-deficient patients (PMID: 17923503).
  26. Analysis of NK cells and TCR alpha/beta expressing T lymphocytes in body effusions (PMID: 18803280).
  27. Notch signaling in human T-cell development (PMID: 19056690).
  28. CD3 epsilon heterodimerization with CD3 gamma or delta (PMID: 19724882).
Database Links

HGNC: 1673

OMIM: 186790

KEGG: hsa:915

STRING: 9606.ENSP00000300692

UniGene: Hs.504048

Involvement In Disease
Immunodeficiency 19 (IMD19)
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
CD3D is mostly present on T-lymphocytes with its TCR-CD3 partners. Present also in fetal NK-cells.

Q&A

What is CD3D and what is its role in the T cell receptor complex?

CD3D (CD3 delta chain) is an invariant chain of the T cell receptor-CD3 complex essential for TCR assembly, transport, and cell surface expression. It forms a heterodimer with CD3ε (CD3D-CD3ε) that pairs with the CD3γ-CD3ε heterodimer and the ζζ/CD247 homodimer to create the complete TCR complex . Although CD3D shares high sequence homology with CD3γ (57% amino acid homology between human and mouse), these proteins have distinct and non-redundant functions in TCR assembly and signaling . Methodologically, researchers investigating CD3D structure-function relationships typically use techniques such as co-immunoprecipitation, FRET analysis, and site-directed mutagenesis to study its interactions within the TCR complex.

How does CD3D expression correlate with immune cell infiltration in tumors?

CD3D expression strongly correlates with tumor-infiltrating immune cells, particularly T cells. High CD3D expression is associated with increased infiltration of CD8+ T cells, CD4+ memory T cells, B cells, NK cells, M1 macrophages, and dendritic cells . Research shows that CD3D has the strongest correlation with CD8+ T cells and activated CD4+ memory T cells (Spearman Correlation Coefficient r>0.5) . Methodologically, researchers typically assess this correlation using computational methods such as CIBERSORT and ESTIMATE algorithms on transcriptomic data, followed by validation with immunohistochemistry or flow cytometry to quantify immune cell populations in tissue samples.

What experimental models are available for studying human CD3D?

Several experimental models are available for studying human CD3D:

  • Cell line models: Jurkat T cell lines with stable CD3D knockdown using shRNA

  • Humanized mouse models: Mice with entire CD3 complex (CD3E, CD3D, and CD3G) replaced with human counterparts

  • In vitro T cell development models: Human T-cell progenitors with CD3D knockdown followed by mouse fetal thymus organ cultures

The humanized CD3 EDG mouse model is particularly valuable as it allows for the evaluation of human CD3-targeted therapeutics in vivo while maintaining immune competence . When selecting a model, researchers should consider whether they need to study the protein in isolation (cell lines) or within the context of a complete immune system (humanized mice).

How does CD3D deficiency differ from CD3G deficiency in terms of T cell development?

CD3D deficiency has more severe clinical consequences than CD3G deficiency, despite their structural similarities. In humans:

FeatureCD3D DeficiencyCD3G Deficiency
Clinical PhenotypeSevere immunodeficiencyMild immunodeficiency
T Cell DevelopmentSeverely impairedPartially preserved
TCR Surface Expression<11% of normal (in mature cells)>30% of normal (in mature cells)
ζζ/CD247 IntegrationSeverely compromisedLess affected
ER Retention of TCRStrongStrong

Notably, immature polyclonal T lymphocytes show high plasticity that allows for expression of significant TCR levels that may signal for survival in CD3γ deficiency but not in CD3δ deficiency . This explains the clinical disparities between these immunodeficiencies. Methodologically, researchers should assess both mature and developing T cells when studying these deficiencies, as the impacts differ significantly between developmental stages.

What mechanisms underlie CD3D's prognostic value in different cancer types?

CD3D has emerged as a significant prognostic biomarker in multiple cancer types, including colon adenocarcinoma (COAD) and breast carcinoma (BRCA). The mechanisms underlying its prognostic value include:

  • Immune activation: High CD3D expression correlates with enrichment of immune-related pathways, particularly T cell receptor signaling, natural killer cell-mediated cytotoxicity, and chemokine signaling

  • Correlation with immune checkpoints: CD3D expression strongly correlates with immune checkpoint molecules, suggesting its involvement in regulating T cell function in the tumor microenvironment

  • Association with microsatellite status: CD3D expression decreases with increasing clinical stage and microsatellite status in COAD, potentially reflecting changes in immunogenicity

Methodologically, Gene Set Enrichment Analysis (GSEA) is commonly used to identify the pathways associated with CD3D expression. Multivariate Cox regression analysis can determine whether CD3D is an independent prognostic factor when accounting for other clinical variables . For researchers exploring CD3D as a prognostic biomarker, it is recommended to perform both univariate and multivariate analyses, and to validate findings across independent cohorts.

How can researchers effectively design knockdown experiments to study CD3D function?

When designing knockdown experiments to study CD3D function, researchers should consider:

  • Cell type selection: Effects of CD3D knockdown differ between mature and immature T cells. In mature T cells, CD3D knockdown severely impairs TCR surface expression, whereas immature T cells show more plasticity

  • Knockdown method: Stable shRNA knockdown in Jurkat T cells has been effective for studying CD3D function in mature T cells . For developing T cells, knockdown in T-cell progenitors followed by mouse fetal thymus organ cultures can be used

  • Controls and comparisons: Include CD3G knockdown controls to distinguish between general CD3 complex deficiency effects and CD3D-specific effects

  • Measurement parameters: Assess TCR assembly (co-immunoprecipitation), transport (ER retention markers), surface expression (flow cytometry), and functional outcomes (calcium flux, cytokine production)

A comprehensive experimental design should examine both structural (complex formation) and functional (signaling) aspects of CD3D to fully understand its role in T cell biology.

What are the current approaches for correcting CD3D mutations in CD3 delta SCID?

CD3 delta severe combined immunodeficiency (SCID) is a rare genetic disorder caused by mutations in the CD3D gene. Current approaches for correcting these mutations include:

  • Base editing technology: Recent UCLA-led research has demonstrated that base editing, an ultraprecise form of genome editing, can correct single-letter mutations in the CD3D gene in blood stem cells . This technique allows for direct conversion of one DNA base to another without requiring double-strand breaks

  • Methodological considerations for base editing approaches:

    • Target specificity assessment to minimize off-target effects

    • Optimization of delivery methods for hematopoietic stem cells

    • Evaluation of edited cells' ability to develop into functional T cells

    • Long-term engraftment studies in immunodeficient mouse models

Base editing represents a promising one-time treatment approach for CD3 delta SCID, potentially restoring normal T cell development from corrected blood stem cells . Researchers working on genetic correction of CD3D should carefully assess both editing efficiency and functional recovery of T cell development in their experimental designs.

How does CD3D interact with immune checkpoints, and what are the implications for cancer immunotherapy?

CD3D expression shows strong positive correlation with immune checkpoint molecules, suggesting complex interactions within the tumor microenvironment:

  • Correlation patterns: Analysis of TCGA data reveals that CD3D expression positively correlates with multiple immune checkpoints in both COAD and BRCA . This suggests that tumors with high CD3D expression may have both active anti-tumor immunity and accompanying immunosuppressive mechanisms

  • Mechanistic implications: The association between CD3D and immune checkpoints suggests that CD3D may play a role in regulating T cell functions in the tumor microenvironment, potentially through:

    • Direct physical interactions with checkpoint molecules

    • Shared regulatory pathways affecting both CD3D and checkpoint expression

    • Sequential upregulation where T cell activation (marked by CD3D) induces checkpoint expression as a feedback mechanism

  • Therapeutic implications: The strong correlation between CD3D and immune checkpoints suggests potential synergy between CD3-targeted therapies and immune checkpoint inhibitors . Tumors with high CD3D expression may be more responsive to checkpoint inhibition due to the presence of activated T cells

Researchers investigating these interactions should employ co-immunoprecipitation, proximity ligation assays, and functional studies with checkpoint inhibitors in the presence of varying CD3D expression levels to elucidate the precise relationships.

What methodological approaches are most effective for studying CD3D in single-cell analyses of the tumor microenvironment?

Single-cell analysis offers unique insights into CD3D function within heterogeneous tumor microenvironments. Effective methodological approaches include:

  • Single-cell RNA sequencing (scRNA-seq): This technique can reveal CD3D expression patterns in different T cell subsets within the tumor microenvironment. Evidence shows that CD3D is highly expressed in CD8+ T cells infiltrating tumors

  • Analytical considerations for scRNA-seq data:

    • Dimensional reduction techniques (tSNE, UMAP) to visualize CD3D-expressing cell clusters

    • Trajectory analysis to track CD3D expression changes during T cell differentiation/exhaustion

    • Integration with TCR sequencing to link CD3D expression with TCR clonality

    • Cell-cell interaction analyses to identify communication between CD3D+ cells and other immune or tumor cells

  • Spatial transcriptomics: Combining CD3D expression data with spatial information can reveal the relationship between CD3D+ T cells and tumor architecture, including invasive margins versus tumor core localization

  • Validation approaches: Multiplex immunofluorescence to confirm co-expression of CD3D with other markers identified in scRNA-seq, particularly immune checkpoints and activation/exhaustion markers

Researchers should combine these approaches to comprehensively characterize CD3D+ cells' phenotypes, functions, and spatial distributions within the tumor microenvironment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.