Recombinant Human T-cell surface glycoprotein CD3 zeta chain (CD247)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Immune Signaling

CD247 is essential for TCR signal transduction. Its cytoplasmic immunoreceptor tyrosine-based activation motifs (ITAMs) recruit kinases like ZAP70, initiating downstream pathways upon antigen recognition . Key functions include:

  • T-Cell Activation: Phosphorylated ITAMs enable ZAP70 binding, triggering proliferation and cytokine production .

  • Thymocyte Development: Critical for intrathymic T-cell differentiation .

  • Pathological Implications: Low CD247 expression correlates with impaired immune responses and autoimmune disorders .

Applications in Research

Recombinant CD247 is widely used in:

  • Mechanistic Studies: Elucidating TCR signaling dynamics and immune synapse formation .

  • Disease Models:

    • Hypertension: CD247-deficient Dahl SS rats exhibit reduced renal T-cell infiltration, lower blood pressure, and attenuated kidney damage under high-salt diets .

    • Immunodeficiency: Mutations in CD247 are linked to T-cell deficiencies (e.g., Immunodeficiency 25) .

  • Diagnostic Tools: ELISA kits (e.g., CSB-EL004904HU) quantify CD247 in serum, plasma, and tissues .

Hypertension and Renal Disease

  • Model: Dahl salt-sensitive (SS) rats with CD247 knockout (KO) showed:

    • Blood Pressure: 134 ± 1 mmHg (KO) vs. 151 ± 2 mmHg (wild type) .

    • Renal Damage: Urinary albumin reduced by 65% in KO rats .

  • Mechanism: CD247 deletion reduced renal T-cell infiltration by 84%, implicating T-cells in salt-sensitive hypertension .

Therapeutic Potential

  • Targeting CD247 signaling could mitigate hypertension-driven organ damage .

  • Recombinant CD247 aids in developing CAR-T therapies by optimizing TCR engineering .

References

  1. CD247 gene structure and isoforms .

  2. Recombinant production and purity data .

  3. CD247 role in hypertension .

  4. Commercial product specifications .

  5. Clinical implications of CD247 mutations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CD247; CD3Z; T3Z; TCRZ; T-cell surface glycoprotein CD3 zeta chain; T-cell receptor T3 zeta chain; CD antigen CD247
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-164
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
QSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Uniprot No.

Target Background

Function
The CD3 zeta chain (CD247) is a transmembrane glycoprotein component of the T-cell receptor (TCR)-CD3 complex on the surface of T lymphocytes. It plays a crucial role in adaptive immune responses. Upon TCR activation by antigen-presenting cells (APCs), CD3 chains (CD3δ, CD3ε, CD3γ, and CD3ζ) transmit signals across the cell membrane. Each chain contains immunoreceptor tyrosine-based activation motifs (ITAMs) in its cytoplasmic domain. Phosphorylation of these ITAMs by Src kinases (Lck and Fyn) following TCR engagement initiates downstream signaling pathways. Specifically, CD3ζ ITAM phosphorylation creates docking sites for ZAP-70 kinase, leading to its activation and subsequent downstream signaling. CD3ζ also plays a significant role in thymic T-cell development and activity-dependent synapse formation in retinal ganglion cells.
Gene References Into Functions

Related Research:

  1. Data confirm previous findings that CD247 polymorphisms are primarily associated with systemic lupus erythematosus clinical outcomes rather than susceptibility. PMID: 30064597
  2. Analysis demonstrates that CD16A interacts equally well with human CD247 and FcεR1γ homodimers in FcepsilonR1alpha assembly and surface expression. PMID: 28652325
  3. Long-term lung function decline in asthma is associated with increased bronchial CD8 and CD4 at baseline, and CD8, CD3, and granzyme B at follow-up. PMID: 27230446
  4. Crk-dependent increased CD3ζ phosphorylation correlated with inhibited TCR downmodulation, suggesting a positive role for Crk adaptor proteins in TCR signal amplification. PMID: 28465009
  5. Immunohistochemical staining patterns of CD3 and CD20 were investigated in malignant lymphoma cells. PMID: 28442514
  6. CD274 upregulation in new-onset type 1 diabetes mellitus correlates with disease pathogenesis. PMID: 28577136
  7. Findings suggest that CD247 gene polymorphism (rs858554) may be associated with rheumatoid arthritis susceptibility. PMID: 27118209
  8. CD3/28-activated T cells expanded in IL-7 and IL-15 produced greater expansion of memory stem T cells and central memory T cell-derived T cells compared with IL-2. This strategy provides a powerful tool to elucidate the characteristics of CAR-modified T cells and reveals the functional properties of each expanded T cell subset, regardless of the expansion protocol. PMID: 28550199
  9. Multiple mutations were identified in CD247 cDNAs cloned from a patient and in cDNA and genomic DNA from other individuals, indicating frequent genetic variation in this gene. PMID: 28743717
  10. A single-nucleotide polymorphism in the CD247 gene is associated with sclerotic graft-versus-host disease. PMID: 27313329
  11. CD3ζ hypermethylation significantly correlated with SLE, representing an SLE risk factor modifiable by environmental factors and associated with more severe clinical manifestations related to impaired T cell function by downregulating the CD3ζ chain. PMID: 27940592
  12. Linkage and association studies revealed a chromosomal region containing CD247, a novel type 1 diabetes (T1D)/autoimmune thyroid disease (AITD) susceptibility gene, showing association between T1D/AITD and several variants in this gene. These results suggest that common susceptibility genes interact with CD247 variants to increase genetic risk for T1D/AITD. PMID: 27716086
  13. SRSF1 regulates CD3ζ expression in human T cells and may contribute to T cell defects in systemic lupus erythematosus. PMID: 26134847
  14. In localized colorectal cancer, mRNA-based CD3ζ/CD8 profiling of tumor immune response may have stage, site, and tissue-specific prognostic significance, along with ESR1 expression. PMID: 25970543
  15. CD247 was identified among key genes in circulating monocytes altered by exercise. PMID: 26207425
  16. This study independently confirms and extends the association of SLE with CD247, shared by various autoimmune disorders, supporting a common T-cell-mediated mechanism. PMID: 25569266
  17. Decreased CD3 surface expression, reduced ZAP-70 abundance, and increased histone H3-acetylation were observed in activated T lymphocytes after 5 minutes of clinorotation, along with transient downregulation of CD3 and stable downregulation of IL-2R. PMID: 25661802
  18. The TCR-CD3 complex and Lck kinase were required for Ca(2+) mobilization but not apoptosis induction in Jurkat cells. PMID: 25947381
  19. Findings suggest that PTPN22 and CD28 are involved in T cell activation in T1D development in Tunisian families. ZAP70 and TCRβ/CD3ζ seem to contribute to disease susceptibility in this population. PMID: 25448703
  20. A CD247 defect leads to naive, hyporesponsive γδ and αβ T cell accumulation in thymoma patients, causing a novel acquired T cell immunodeficiency and immune dysregulation. PMID: 25732729
  21. CD247 downregulation was associated with disease severity, complications, and future cardiovascular events, suggesting its potential as a diagnostic and prognostic biomarker. PMID: 25368105
  22. Decreased TCRζ chain, ZAP-70 kinase, and FcεRIγ expression levels significantly correlated with disease progression. PMID: 25513989
  23. Myeloid-derived suppressor cell frequency in peripheral blood directly correlates with HCV RNA load and inversely correlates with TCRζ chain expression in CD8(+) T cells. PMID: 24552712
  24. Two transcription factor binding sites and a long non-coding RNA were identified within the Cd247 gene. PMID: 24797614
  25. LAT modulates CD3ζ and ZAP-70 tyrosine phosphorylation. PMID: 24204825
  26. Deficient lipid rafts recruitment of CD3ζ/ZAP-70/Grb2 was observed, and these proteins did not merge with GM1 within the lipid rafts. PMID: 23916875
  27. This study shows a GWAS-level association between a CD247 polymorphism and RA risk. PMID: 23861880
  28. This review examines the potential roles of CD247 gene variants and single-nucleotide polymorphisms in systemic lupus erythematosus pathogenesis. PMID: 23525753
  29. Low expression of the T-cell antigen receptor complex zeta is associated with chronic myeloid leukemia. PMID: 23228155
  30. TCRζ gene transfection restored TCRζ chain deficiency and enhanced IL-2 production in T cells from chronic myeloid leukemia (CML) patients. PMID: 23057733
  31. CD8α/CD3ζ rescues pertussis toxin-induced signaling events lacking in TCR null cells, suggesting that CD8α/CD3ζ can substitute for TCR and supports the hypothesis that pertussis toxin stimulates signaling via receptor cross-linking. PMID: 22551306
  32. These data provide evidence for src-like adaptor protein-dependent regulation of CD3ζ chain in fine control of TCR signaling. PMID: 22798681
  33. The rs12133337 polymorphism in the CD3Z gene might affect the immune response to hepatitis B vaccination, and a lower BMI might increase the polymorphism's contribution to immunity. PMID: 22536368
  34. A novel juvenile idiopathic arthritis susceptibility locus, CD247, was identified. PMID: 22294642
  35. Peripheral blood lymphocytes (PBLs) from ovarian cancer patients showed lower JAK3 and CD3-ζ expression levels, and lower STAT3 and CD3-ζ phosphorylation levels than controls. PMID: 22221142
  36. The CD3-ζ chimeric antigen receptor overcomes TCR hyporesponsiveness in human terminal late-stage T cells. PMID: 22292024
  37. Data show a significant association between CD247 variants and systemic lupus erythematosus in Asian populations. PMID: 22004975
  38. CD247 is identified as a systemic sclerosis susceptibility gene. PMID: 21474487
  39. Lower CD3ζ expression was found in chronic myeloid leukemia patients compared to controls. PMID: 20723304
  40. CD247 is identified as a new susceptibility locus for systemic sclerosis. PMID: 20383147
  41. ASF/SF2 is a novel regulator of CD3ζ 3'-UTR alternative splicing and protein expression in human T cells. PMID: 20118245
  42. B7-H1 blockade significantly promoted CD3AK cell proliferation and extended their in vitro survival time. PMID: 19664385
  43. CD3ζ transcripts and protein were absent from most solid tumor-TILs from ovarian cancer patients but expressed in ASC-TILs and PBMCs from these patients. PMID: 20032419
  44. T cells with a recombinant CD3ζ/CD28 signaling receptor secrete high amounts of IL-2 upon antigen binding without exogenous B7/CD28 costimulation, demonstrating that a single chimeric receptor molecule can deliver complete T cell activation. PMID: 11714771
  45. Experimental, computational, and evolutionary approaches predict a tetrameric form for CD3-ζ. PMID: 11851345
  46. TCR-signaling pathways are differentially affected by physiological levels of oxidative stress. PMID: 11916964
  47. Reduced expression in tumor-infiltrating lymphocytes strongly correlated with progressive disease in gastric carcinoma. PMID: 11920499
  48. L-arginine regulates T cell receptor CD3ζ chain expression. PMID: 11950832
  49. Defective expression and altered tyrosine phosphorylation of TCRζ were found in many SLE patients, suggesting an important role in T cell dysfunction. PMID: 12100036
  50. ZAP-70, crucial for T cell activation, is a key player in TCR down-modulation and ζ degradation. PMID: 12165490
Database Links

HGNC: 1677

OMIM: 186780

KEGG: hsa:919

STRING: 9606.ENSP00000354782

UniGene: Hs.156445

Involvement In Disease
Immunodeficiency 25 (IMD25)
Protein Families
CD3Z/FCER1G family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
CD3Z is expressed in normal lymphoid tissue and in peripheral blood mononuclear cells (PBMCs).

Q&A

What is the primary role of CD3 zeta chain (CD247) in T cell function?

The CD3 zeta chain serves as an essential component of the TCR-CD3 complex present on T-lymphocyte cell surfaces, playing a critical role in adaptive immune response. Its primary function is to transduce signals from the cell surface to the interior of the T cell when antigen presenting cells (APCs) activate the T-cell receptor . The CD3 zeta chain contains multiple immunoreceptor tyrosine-based activation motifs (ITAMs) in its cytoplasmic domain that become phosphorylated upon TCR engagement by Src family protein tyrosine kinases LCK and FYN. This phosphorylation creates docking sites for ZAP70, leading to its activation and subsequent downstream signaling cascade initiation . Additionally, CD3 zeta plays an important role in intrathymic T-cell differentiation and participates in activity-dependent synapse formation of retinal ganglion cells .

What are the key structural features of recombinant CD3 zeta protein?

Recombinant human CD3 zeta protein is typically expressed as a fragment containing amino acids 62-164 of the native protein sequence. The protein can be produced in expression systems such as Escherichia coli with high purity (>90%) and is suitable for various analytical techniques including SDS-PAGE and mass spectrometry . A typical recombinant CD3 zeta protein sequence includes a histidine tag for purification purposes followed by the protein sequence containing the ITAMs essential for signaling functions. The recombinant protein maintains the key functional domains necessary for studying signaling mechanics, protein-protein interactions, and structural biology . The availability of such well-characterized recombinant proteins facilitates research into CD247 function, providing standardized materials for experimental investigations.

How can CD247 expression be utilized as a prognostic biomarker in cancer research?

CD247 expression has demonstrated significant prognostic value in various cancers, including head and neck squamous cell carcinoma (HNSC). Research using TCGA data has revealed that patients with high CD247 expression have notably better outcomes compared to those with low expression . Specifically, Kaplan-Meier survival analysis showed that patients with high CD247 expression had a median survival time of 68.8 months and a 5-year survival rate of 52.3%, compared to 30.9 months and 36.4% respectively in the low-expression group (P<0.0001) . Multivariate Cox regression analysis confirmed CD247 as an independent prognostic factor, with high expression serving as a protective factor in HNSC patients.

Furthermore, CD247 expression has been shown to negatively correlate with pathological tumor stage (pT) and pathological nodal extracapsular spread . The risk of developing pT4 stage disease in the high-expression CD247 group was only 36.5% of that in the low-expression group, suggesting CD247 may play a role in reducing pathological tumor progression. This relationship between CD247 expression and clinicopathological features provides researchers with potential mechanistic insights into how T-cell function influences cancer progression and patient outcomes.

Clinical ParameterCorrelation with CD247P-value
Patient AgePositive correlation0.005
Pathological Tumor Stage (pT)Negative correlation0.011
Lymph Node Extracapsular InvasionNegative correlation0.014

What signaling pathways are activated by CD247, and how can researchers study these interactions?

Gene Set Enrichment Analysis (GSEA) has revealed that CD247 expression is significantly associated with the activation of two key immunological pathways: the natural killer cell-mediated cytotoxicity pathway (hsa04650) and the T cell receptor signaling pathway (hsa04660) . Both pathways showed significant enrichment scores (NSE=2.613513 and NSE=2.610915, respectively) with false discovery rate q-values of 0.001, indicating statistically robust associations .

Researchers investigating CD247 signaling can employ multiple methodological approaches. Protein interaction studies using techniques like the STRING database can identify proteins that interact with CD247, focusing on experimental evidence with medium confidence thresholds (0.400) . Correlation analysis using databases such as MEM can verify relationships between CD247 and its potential interacting partners . For functional studies, researchers often employ phosphorylation assays to examine ITAM activation, co-immunoprecipitation to detect protein complex formation, and cell-based assays to assess downstream effects on immune cell activation and function. Advanced approaches including proximity ligation assays, FRET, and single-cell analyses can provide more detailed insights into the spatial and temporal aspects of CD247 signaling dynamics.

How does CD247 expression correlate with disease progression metrics in pulmonary conditions?

Research has demonstrated that CD247 expression can serve as a potential biomarker for disease progression in pulmonary conditions, particularly for diffusing capacity for carbon monoxide (Dlco) decline. Logistic regression analyses have shown that low expression of CD247 at multiple time points (0, 8, and 12 months) represents a risk factor for Dlco% predicted decline ≥15% over 12 months (Dlco15) . Interestingly, this correlation was not observed at the fourth month, suggesting temporal variability in the biomarker's predictive capacity .

Cox regression analysis and Kaplan-Meier analysis further revealed that low CD247 expression at various time points (0, 1, 3, 6, and 12 months) was associated with increased risk of composite endpoint of death or lung transplant (CEP) and significantly shorter transplant-free survival (TFS) time . The predictive power of CD247 for these outcomes was quantified through receiver operating characteristic (ROC) curve analysis, with areas under the curve (AUC) of 0.736 at 1 year and 0.741 at 2 years for CEP, and 0.889, 0.787, and 0.702 at 1, 2, and 3 years respectively for non-TFS in certain datasets . These findings provide researchers with valuable information on CD247's potential utility as a blood-based biomarker for monitoring disease progression in pulmonary conditions.

What are the optimal methods for studying CD247 zeta chain phosphorylation in T-cell signaling experiments?

When designing experiments to study CD247 zeta chain phosphorylation, researchers should consider several methodological approaches to capture both the magnitude and kinetics of this critical signaling event. Phospho-specific antibodies that recognize the phosphorylated ITAMs of CD247 are essential tools, typically employed in western blotting, flow cytometry, or immunofluorescence microscopy applications. For temporal analysis of phosphorylation events, researchers often stimulate T cells with anti-CD3 antibodies, peptide-MHC complexes, or antigen presenting cells at various time points, then rapidly lyse cells to preserve phosphorylation states .

Quantitative techniques such as phospho-flow cytometry allow single-cell resolution analysis of zeta chain phosphorylation in heterogeneous cell populations, enabling researchers to correlate phosphorylation status with other cellular parameters. For mechanistic studies exploring the role of specific kinases in zeta chain phosphorylation, selective inhibitors of Src family kinases (particularly Lck and Fyn) can be employed . Additionally, site-directed mutagenesis of individual ITAM tyrosine residues to phenylalanine allows researchers to dissect the relative contributions of each ITAM to downstream signaling. Mass spectrometry-based phosphoproteomic approaches offer the advantage of identifying novel phosphorylation sites and quantifying phosphorylation stoichiometry with high precision.

What considerations are important when reconstituting zeta-deficient cell lines with CD247 for functional studies?

When reconstituting zeta-deficient T cell lines with CD247 for functional studies, several methodological considerations are crucial for experimental success and interpretability. First, the expression vector and promoter should be carefully selected to achieve physiologically relevant expression levels, as both insufficient and excessive zeta expression can affect results . Using inducible expression systems allows for titration of CD247 levels and observation of dose-dependent effects on TCR assembly and signaling.

The choice between transient and stable transfection depends on experimental goals - stable transfection provides more consistent expression for long-term studies but may introduce clonal selection bias . Researchers should confirm successful reconstitution through multiple techniques: western blotting to verify protein expression, flow cytometry to quantify surface TCR restoration, and functional assays to assess signaling competence. When analyzing reconstituted cells, it's important to examine not only TCR expression but also downstream signaling events such as calcium flux, cytokine production, and cell proliferation in response to various stimuli .

For more sophisticated studies, researchers might consider complementation assays using different CD247 mutants to identify functionally critical domains or residues. Additionally, complementation with CD247 from different species can provide insights into evolutionary conservation of function. Finally, researchers should be aware that reconstitution might not fully recapitulate the stoichiometry and regulation present in wild-type cells, necessitating appropriate controls and cautious interpretation of results.

How can single-cell RNA sequencing be optimized for analyzing CD247 expression in heterogeneous immune cell populations?

Single-cell RNA sequencing (scRNA-seq) has emerged as a powerful technique for analyzing gene expression at cellular resolution, particularly valuable for studying CD247 expression in heterogeneous immune populations. For optimal results, researchers should carefully consider sample preparation protocols to maintain cell viability and minimize stress responses that could alter gene expression. Immediate processing of freshly isolated cells or careful cryopreservation protocols are recommended to preserve the native transcriptional state .

Data processing and analysis require several specialized steps. After quality control filtering, normalization using methods such as SCTransform can account for technical variation . Dimensional reduction techniques like principal component analysis (PCA) followed by uniform manifold approximation and projection (UMAP) facilitate visualization of cell clusters. The first 50 principal components are typically used for UMAP embedding and Louvain clustering, with resolution settings around 0.9 for appropriate cluster granularity . Cell type identification can be accomplished using marker gene databases such as CellMarker and PanglaoDB, with visualization of CD247 expression patterns using DotPlot and FeaturePlot functions .

For trajectory analysis of CD247 expression dynamics, specialized tools like the Lung Injury Regeneration web interface can reveal temporal patterns of expression across different cell states. Integration of scRNA-seq data with other modalities, such as protein expression or chromatin accessibility, provides a more comprehensive understanding of CD247 regulation and function in diverse immune cell populations.

How should researchers address contradictory findings regarding CD247 expression and clinical outcomes across different tissue types?

Researchers facing contradictory findings regarding CD247 expression and clinical outcomes across different tissue types should implement a systematic analytical approach. First, consider tissue-specific microenvironments and their influence on CD247 function. For example, while low CD247 expression in blood samples correlates with poorer outcomes in several datasets, this relationship may not hold in bronchoalveolar lavage fluid (BALF) samples, where no significant association with mortality was observed (p>0.05) .

Methodological variations can substantially impact results. Researchers should thoroughly evaluate differences in sampling techniques, tissue processing methods, and analytical platforms when comparing studies. For instance, the detection methods for CD247 in blood versus tissue samples might have different sensitivities and specificities. Statistical approaches also warrant careful consideration - the optimal cutoff value for CD247 expression may vary between datasets and should be determined using appropriate methods such as Youden index or R packages like "survminer" .

To reconcile contradictory findings, meta-analytical approaches combining multiple datasets can provide greater statistical power and reveal consistent patterns. Additionally, stratification of patients based on clinical features, treatment history, or molecular subtypes may uncover context-dependent relationships between CD247 expression and outcomes. Ultimately, functional validation studies examining the mechanistic role of CD247 in specific tissue contexts are essential for resolving discrepancies and establishing causal relationships rather than mere correlations.

What are the technical challenges in producing and maintaining functional recombinant CD3 zeta proteins?

Producing and maintaining functional recombinant CD3 zeta proteins presents several technical challenges that researchers must address for successful experimental applications. The hydrophobic nature of certain regions of CD247 can cause aggregation during expression and purification, particularly when attempting to produce full-length protein including transmembrane domains. Most commercial recombinant CD247 proteins are therefore produced as fragments (such as amino acids 62-164) that include the functionally important cytoplasmic domain while excluding problematic hydrophobic regions .

Expression systems significantly impact protein quality - while E. coli systems offer high yield and cost-effectiveness, they lack post-translational modifications that may be important for certain applications . Mammalian or insect cell expression systems can provide more native-like modifications but typically result in lower yields. Protein stability presents another major challenge, as recombinant CD247 can be prone to degradation, particularly when phosphorylated. Researchers should optimize buffer conditions (pH, ionic strength, and additives like glycerol) and storage protocols (temperature, aliquoting strategy) to maximize stability.

Functionality assessment is crucial but complex - while structural integrity can be verified through techniques like circular dichroism or limited proteolysis, functional assays typically require incorporation into cellular systems or reconstituted protein complexes. Researchers should consider developing application-specific quality control assays, such as binding assays for interaction partners or in vitro phosphorylation assays, to ensure the recombinant protein maintains its native functions relevant to the intended experimental applications.

How does CD247 expression variation across cell types impact experimental design for immunotherapy research?

The heterogeneous expression pattern of CD247 across different immune cell types necessitates careful consideration in experimental design for immunotherapy research. Flow cytometric analysis reveals variable CD247 expression levels among T cell subsets (CD4+ vs. CD8+), differentiation states (naïve, effector, memory), and activation status . This variability has significant implications for experimental design and interpretation of results in immunotherapy research.

Cell isolation strategies should be carefully evaluated, as enrichment methods may inadvertently select for cells with particular CD247 expression profiles. For functional studies, researchers should consider analyzing CD247 expression before and after various stimulation protocols to account for dynamic regulation. When developing CD247-targeted therapies or using CD247 as a biomarker, the specific immune cell populations being targeted or analyzed must be clearly defined and consistently isolated across experiments .

In animal models and clinical studies, environmental factors and disease states that modulate CD247 expression must be controlled for or systematically evaluated. For instance, chronic inflammation, certain medications, and comorbidities can alter CD247 expression independent of the experimental intervention. Single-cell approaches are increasingly valuable for addressing this heterogeneity, allowing researchers to correlate CD247 expression with cell type, functional state, and response to therapy at the individual cell level . This granular understanding enables more precise targeting of specific immune cell populations in next-generation immunotherapeutic approaches.

What emerging technologies show promise for elucidating CD247's role in immunological synapse formation?

Advanced imaging technologies are revolutionizing our understanding of CD247's role in immunological synapse formation. Super-resolution microscopy techniques such as STORM (Stochastic Optical Reconstruction Microscopy) and PALM (Photoactivated Localization Microscopy) now enable visualization of CD247 organization within the synapse at nanometer-scale resolution, revealing previously undetectable spatial arrangements and clustering patterns. These approaches, when combined with multi-color imaging, allow researchers to simultaneously track CD247 in relation to other TCR components, signaling molecules, and cytoskeletal elements during synapse formation .

Live-cell imaging with techniques like lattice light-sheet microscopy provides unprecedented temporal resolution for studying CD247 dynamics during T cell activation. By incorporating genetically encoded biosensors, researchers can monitor CD247 phosphorylation status, protein-protein interactions, and downstream signaling events in real time within living cells. Correlative light and electron microscopy (CLEM) offers another promising approach, combining functional information from fluorescence microscopy with ultrastructural details from electron microscopy to provide comprehensive insights into the molecular architecture of CD247-containing complexes .

Emerging proteomics approaches, including proximity labeling techniques like BioID and APEX, allow researchers to identify proteins that transiently interact with CD247 during immunological synapse formation. These methods provide a more comprehensive understanding of the dynamic protein network surrounding CD247 in its native cellular context. Integration of these advanced technologies with computational modeling is beginning to yield systems-level insights into how CD247 contributes to the complex process of immunological synapse formation and T cell activation.

How might single-cell multi-omics approaches advance our understanding of CD247 in disease contexts?

Single-cell multi-omics approaches represent a frontier in understanding CD247's role in disease contexts by simultaneously profiling multiple molecular features within individual cells. Integration of single-cell transcriptomics (scRNA-seq) with proteomics (CITE-seq) enables correlation of CD247 mRNA expression with protein levels, revealing post-transcriptional regulation mechanisms that may be altered in disease states . This approach has particular value in heterogeneous tissues where conventional bulk analyses would mask cell type-specific alterations in CD247 regulation.

Single-cell epigenomic profiling through techniques like scATAC-seq provides insights into the chromatin accessibility landscape controlling CD247 expression in different cell populations. When integrated with transcriptomic data, these analyses can identify key regulatory elements and transcription factors that drive aberrant CD247 expression in disease contexts . Emerging spatial transcriptomics and proteomics methods add another dimension by preserving tissue context, allowing researchers to examine how CD247 expression varies according to the local microenvironment and cellular neighborhoods.

The computational integration of these multi-omic datasets presents both opportunities and challenges. Advanced analytical frameworks employing machine learning algorithms can identify complex patterns and relationships between CD247 expression, cellular phenotypes, and disease progression that would not be apparent from single-modality analyses . These integrated approaches are particularly valuable for identifying disease-specific cell states characterized by unique CD247 expression patterns, potentially leading to more precise biomarkers and therapeutic targets for conditions ranging from autoimmune disorders to cancer.

What are the potential applications of CD247 as a therapeutic target in immunological disorders?

CD247 presents several promising avenues as a therapeutic target in immunological disorders, stemming from its central role in TCR signaling and expression. Modulating CD247 expression or function could potentially recalibrate aberrant T cell responses in both autoimmune conditions and cancer. In autoimmune contexts, where hyperactive T cell responses contribute to pathology, targeted reduction of CD247 signaling capacity could dampen inappropriate immune activation. Conversely, in cancer immunotherapy, enhancing CD247 expression or function in tumor-infiltrating lymphocytes might improve anti-tumor immune responses .

Several therapeutic strategies targeting CD247 show promise in preclinical research. Small molecule inhibitors targeting specific protein-protein interactions involving CD247 could modulate signaling without completely abrogating T cell function. Engineered T cells with modified CD247 domains, particularly in CAR-T cell designs, can provide optimized signaling properties for specific therapeutic applications . Additionally, gene therapy approaches aimed at restoring normal CD247 expression in conditions where it is downregulated could potentially reverse immune dysfunction.

The prognostic value of CD247 in multiple disease contexts suggests its potential as a companion diagnostic or treatment response biomarker . Monitoring CD247 expression before and during therapy could help identify patients likely to respond to immunomodulatory treatments and detect early signs of treatment efficacy or resistance. As with any immunomodulatory target, the challenge lies in achieving sufficient specificity to avoid broad immunosuppression while effectively modulating the relevant pathological processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.