Recombinant Human Tail-anchored protein insertion receptor WRB (WRB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human WRB and Its Role in Tail-Anchored Protein Insertion

WRB (Wnt1 Responsive Bone protein), also known as CHD5 (Congenital Heart Disease Protein 5), is a transmembrane receptor critical for the post-translational insertion of tail-anchored (TA) proteins into the endoplasmic reticulum (ER) membrane. Recombinant WRB refers to engineered versions of this protein produced in vitro for experimental or therapeutic purposes. It functions as part of the TRC40 pathway, collaborating with CAML (Calcium-Modulating Cyclophilin Ligand) to mediate TA protein targeting and membrane integration .

Functional Interactions of WRB with TRC40 and CAML

WRB forms a heterodimeric receptor complex with CAML, which is essential for TRC40-mediated TA protein insertion. Below are key findings from biochemical and structural studies:

ComponentRole in TA Protein InsertionSource
WRBBinds TRC40 via its coiled-coil domain, anchoring the complex to the ER membrane.
CAMLStabilizes WRB and facilitates TRC40 interaction; present in molar excess over WRB.
TRC40ATPase that binds TA proteins in the cytosol and delivers them to the WRB-CAML receptor.

Mechanistic Insights:

  • WRB recruits TRC40 to the ER membrane, enabling TA protein delivery .

  • CAML stabilizes WRB, and its absence destabilizes WRB mRNA, leading to reduced protein levels .

  • WRB’s coiled-coil domain competitively inhibits TRC40-mediated insertion in vitro, confirming its role as a docking site .

Experimental Applications of Recombinant WRB Domains

Recombinant WRB variants have been instrumental in elucidating its function:

3.1. Soluble Coiled-Coil Domain (WRBcc)

  • Expression: Purified WRBcc (fused to maltose-binding protein) was expressed in E. coli and used to study TRC40 binding .

  • Function: WRBcc directly binds TRC40 and blocks TA protein insertion in vitro, reducing glycosylation of substrates like HZZ-RAMP4op by up to 92% .

TA ProteinInhibition by WRBccExperimental SystemSource
HZZ-RAMP4op92% reductionRough microsomes (RMs)
Cytochrome b5 (Cb5)Partial reductionTRC40-dependent insertion

3.2. In Vitro Membrane Reconstitution

  • Proteoliposomes: Recombinant WRB and CAML were reconstituted into liposomes to mimic ER membrane targeting. These liposomes supported TRC40-dependent TA protein insertion, confirming the sufficiency of WRB-CAML for this process .

In Vivo Studies: Tissue-Specific Roles of WRB

Mouse models with tissue-specific WRB knockouts revealed critical dependencies:

TissueWRB Depletion EffectKey TA Protein AffectedSource
CardiomyocytesReduced CAML and TRC40 levels; severe proteostasis defects.Syntaxin 5 (Stx5)
HepatocytesLiver damage, fibrosis, and reduced Stx5/Stx6 levels.Syntaxin 5/6

Key Findings:

  • Syntaxin 5 (Stx5) exhibited extreme sensitivity to WRB depletion, linked to its aggregation-prone cytoplasmic domain .

  • CAML stability depends on WRB; WRB knockout leads to CAML degradation via the proteasome .

5.1. Implications for Disease

  • Congenital Heart Disease: WRB is located on chromosome 21 and implicated in Down syndrome-associated heart defects .

  • Hearing Loss: WRB-deficient hair cells show reduced otoferlin levels, critical for mechanotransduction .

5.2. Technical Limitations

  • Low Endogenous Levels: Detecting native WRB in cells is challenging, necessitating overexpression for functional studies .

  • CAML Stoichiometry: CAML exists in ~5-fold excess over WRB, complicating receptor complex dynamics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Please specify your desired tag type for preferential development.
Synonyms
GET1; CHD5; WRB; Guided entry of tail-anchored proteins factor 1; Congenital heart disease 5 protein; Tail-anchored protein insertion receptor WRB; Tryptophan-rich basic protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-174
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
WRB
Target Protein Sequence
MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQESQMRAEIQDMKQEL STVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIKWVISVAFYVLQAALMISLI WKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGVGITCWILVCNKVVAIVLHPFS
Uniprot No.

Target Background

Function
WRB is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). It functions as a membrane receptor, in conjunction with CAMLG/GET2, for soluble GET3/TRC40. This complex recognizes and specifically binds the transmembrane domain of TA proteins in the cytosol, ensuring the correct topology and ER insertion of CAMLG.
Gene References Into Functions
  1. The WRB gene contains a maternally imprinted differentially methylated region (DMR). Maternally inherited 5mCpG imprints at the WRB DMR are not coupled to the parental allele expression of WRB and ten neighboring genes across twelve tissue types (brain, blood, fallopian tube, fetal large and small intestine, hESCs, large airway epithelial cells, thyroid, muscle, epidermal keratinocytes, ovary, skin, and testis). PMID: 27100087
  2. Studies identify calcium-modulating cyclophilin ligand (CAML) and WRB as components of the TRC40 receptor complex, a critical mechanism for ER membrane insertion of TA proteins in mammalian cells. PMID: 23041287
  3. The coiled-coil domain of WRB serves as the binding site for TRC40/Asna1. PMID: 21444755
Database Links

HGNC: 12790

OMIM: 602915

KEGG: hsa:7485

STRING: 9606.ENSP00000327716

UniGene: Hs.198308

Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.