Recombinant Human Taste receptor type 2 member 10 (TAS2R10)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

TAS2R10 exhibits broad ligand specificity, recognizing over 30 bitter compounds. Key findings include:

Ligand Interactions

LigandEffectMechanism
StrychnineStrong activation (EC₅₀ ~1 µM) Binds via hydrogen bonds and hydrophobic interactions in the TM III–VII pocket.
Denatonium BenzoateActivation (EC₅₀ ~10 µM) Competes with strychnine, suggesting overlapping binding sites.
ParthenolideModerate activation (EC₅₀ ~50 µM) Docks into the pocket via distinct residues compared to strychnine.

Mutagenesis studies show that residues Q175 (TM5) and R3.29 (TM3) are critical for ligand discrimination .

Recombinant TAS2R10 Production and Applications

Recombinant TAS2R10 proteins are produced in E. coli or wheat germ systems with tags (GST or His) for purification.

Non-Taste Functions and Pathway Involvement

Bioinformatics and functional studies reveal roles beyond bitter perception:

Key Pathways and Processes

PathwayRoleEvidence
Ubiquitin-Mediated ProteolysisRegulates protein degradation via ANAPC5 (anaphase-promoting complex subunit 5) .Co-expression with ANAPC5 in thyroid tissue .
Salmonella InfectionModulates immune response to pathogens.Linked to Salmonella infection pathways in KEGG analysis .
Cytokine RegulationInhibits LPS-induced cytokine release in lung macrophages.TAS2R10 agonists (e.g., chloroquine) suppress TNF-α and CXCL8 production .

Therapeutic Potential

  • Anti-Inflammatory: TAS2R10 agonists reduce airway inflammation in asthma models .

  • Antitumor: Suggested tumor-suppressive activity via cell cycle regulation .

Research Challenges and Future Directions

  • Selectivity: TAS2R10’s broad tuning complicates agonist specificity studies.

  • Structural Gaps: No crystal structures exist for TAS2R10; homology models remain critical .

  • Clinical Translation: Investigating TAS2R10’s role in lung diseases and cancer requires selective agonists/antagonists.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for the specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R10; Taste receptor type 2 member 10; T2R10; Taste receptor family B member 2; TRB2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWI IITDGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLW LKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKTKNDTVWDLNMYKSEYFIKQILLNL GVIFFFTLSLITCIFLIISLWRHNRQMQSNVTGLRDSNTEAHVKAMKVLISFIILFILYF IGMAIEISCFTVRENKLLLMFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEK RKNLRVT
Uniprot No.

Target Background

Function
Gustducin-coupled strychnine receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Gene References Into Functions
  1. The human bitter taste receptor TAS2R10 is tailored to accommodate numerous diverse ligands PMID: 23283334
Database Links

HGNC: 14918

OMIM: 604791

KEGG: hsa:50839

STRING: 9606.ENSP00000240619

UniGene: Hs.533756

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.

Q&A

Basic Research Questions

  • What is TAS2R10 and what is its primary biological role?

    TAS2R10 is a G-protein-coupled receptor belonging to the type 2 taste receptor (TAS2R) family responsible for bitter taste perception. While originally characterized for its role in bitterness sensing on the tongue, TAS2R10 functions as a broadly tuned receptor, recognizing approximately one-third of bitter compounds tested in research settings . Its primary evolutionary purpose appears to be protection against ingestion of toxic substances, as many bitter compounds are potentially harmful . Beyond taste function, bioinformatics analyses reveal TAS2R10 involvement in multiple biological processes including cellular protein metabolic processes, protein modification, and cellular component assembly . To study its function, researchers should employ both in vitro systems with heterologous expression and calcium imaging, alongside tissue-specific knockdown approaches to distinguish its functions in different physiological contexts.

  • Where is TAS2R10 expressed in the human body?

    TAS2R10 exhibits a wide expression pattern extending far beyond the tongue. Expression profiling studies have detected TAS2R10 in multiple extra-oral tissues including the gastric and intestinal mucosa, respiratory tract, bladder, pancreas, testes, and central nervous system . Experimentally validated cell lines expressing TAS2R10 include HeLa (cervical cancer), TPC1 (thyroid cancer), and CAPAN-2 (pancreatic cancer), suggesting tissue-specific functions in uterine, thyroid, and pancreatic tissues . Expression was notably absent in cell lines representing kidney (HEK293), liver (HEPG2), lung (A549), colon (Caco-2), breast (MCF7), and bladder (RT4) tissues . For researchers examining TAS2R10 expression in novel tissues, RT-qPCR combined with western blotting provides reliable detection, while immunohistochemistry can provide spatial localization within tissue architecture. Single-cell RNA sequencing can further define cell-type specific expression patterns within heterogeneous tissues.

  • What functional domains and key residues of TAS2R10 are critical for ligand binding?

    Molecular studies of TAS2R10 have identified several critical residues that mediate its interaction with agonists. Most notably, site-directed mutagenesis experiments have demonstrated that mutations in S85(3.29) and Q175(5.40) have differential impacts on receptor activation by different agonists . These residues appear to be particularly important for the receptor's broad tuning characteristic. The binding pocket has evolved to accommodate multiple agonists, sacrificing high potency for individual compounds in favor of recognizing a wider range of bitter substances . For experimental characterization of binding interactions, researchers should employ comparative molecular modeling combined with systematic site-directed mutagenesis followed by functional calcium mobilization assays. This approach can identify residue-specific contributions to ligand selectivity and receptor activation. Alanine-scanning mutagenesis across predicted transmembrane domains can systematically map the complete binding pocket architecture.

  • How does TAS2R10 signal transduction function at the molecular level?

    TAS2R10 functions as a classical G-protein-coupled receptor (GPCR), transmitting signals through heterotrimeric G-proteins. Upon ligand binding, TAS2R10 undergoes conformational changes that activate G-proteins, primarily gustducin in taste cells, triggering downstream signaling cascades. This includes activation of phospholipase C (PLC), generation of inositol trisphosphate (IP3), and subsequent calcium release from intracellular stores. Beyond this canonical pathway, bioinformatics analyses suggest TAS2R10 may play roles in multiple signaling networks including ubiquitin-mediated proteolysis, retrograde endocannabinoid signaling, and progesterone-mediated oocyte maturation . To investigate TAS2R10 signaling, researchers should employ calcium imaging techniques using fluorescent indicators (Fura-2AM), BRET/FRET assays to measure direct G-protein coupling, and phosphoproteomic approaches to map downstream signaling events. Pharmacological inhibitors targeting specific pathway components can help delineate the signaling networks involved in different cellular contexts.

  • What are the common agonists of TAS2R10 and how are they experimentally characterized?

    TAS2R10 responds to numerous bitter compounds, with strychnine being a well-characterized and potent agonist . Other agonists include various natural and synthetic bitter substances. The receptor is considered "broadly tuned" as it recognizes approximately one-third of tested bitter compounds . For experimental characterization of TAS2R10 agonists, researchers should use heterologous expression systems (such as HEK293T cells transiently transfected with TAS2R10) combined with calcium flux assays to generate dose-response curves. This allows determination of EC50 values and efficacy parameters. Competitive binding assays using labeled reference ligands can further characterize binding affinity (Ki values). Structure-activity relationship studies with systematically modified ligands can identify pharmacophore requirements for TAS2R10 activation. Novel agonist screening should include natural product libraries and compounds with structural similarity to known agonists.

Advanced Research Questions

  • What methodologies are most effective for investigating the extra-oral functions of TAS2R10?

    Investigating TAS2R10's extra-oral functions requires integrated approaches spanning multiple biological levels. At the cellular level, CRISPR-Cas9 mediated knockout or knockdown of TAS2R10 in relevant cell types (such as smooth muscle cells, immune cells, or pancreatic cells) allows functional characterization through phenotypic assays. These may include contractility measurements for smooth muscle, cytokine production for immune cells, or secretory function for pancreatic cells. Tissue-specific conditional knockout mouse models provide in vivo platforms to study physiological roles. For established functions like smooth muscle relaxation, ex vivo tissue preparations can be used with selective TAS2R10 agonists and antagonists while measuring contractile responses. To investigate TAS2R10's role in ubiquitin-mediated proteolysis, co-immunoprecipitation with ANAPC5 and ubiquitin ligase complexes followed by mass spectrometry can identify interactors . For studying Salmonella infection, cellular infection models with genetic manipulation of TAS2R10 expression can determine its impact on bacterial invasion, intracellular survival, and immune response. RNA-seq analysis comparing wild-type and TAS2R10-deficient cells under relevant stimuli can reveal regulated gene networks and downstream effectors.

  • How can researchers effectively produce and purify recombinant TAS2R10 for structural and functional studies?

    Production of functional recombinant TAS2R10 presents significant challenges due to its multiple transmembrane domains and potential for misfolding. For effective expression, researchers should employ specialized expression systems optimized for membrane proteins. Insect cell expression (Sf9, High Five) using baculovirus vectors offers advantages for GPCR expression with proper folding and post-translational modifications. Alternatively, mammalian expression systems (HEK293-GnTI- cells) can be used with inducible promoters. Fusion tags that enhance expression and solubility are critical - N-terminal tags such as maltose-binding protein (MBP) or thermostabilized apocytochrome b562RIL (BRIL) can improve yield, while C-terminal tags facilitate purification. Stabilization strategies including: (1) introduction of thermostabilizing mutations identified through alanine scanning; (2) inclusion of lipid-like detergents during solubilization; and (3) addition of stabilizing ligands during purification are essential for maintaining native conformation. Purification should involve a two-step approach with affinity chromatography followed by size exclusion to achieve homogeneity. Functional validation through ligand binding assays or reconstitution into proteoliposomes for signaling studies should confirm protein integrity.

  • How does the binding site of TAS2R10 accommodate multiple agonists and what methodologies can characterize this property?

    The remarkable feature of TAS2R10 is its ability to recognize approximately one-third of tested bitter compounds, though at the expense of high potency for individual agonists . This broad tuning appears to result from an evolutionarily optimized binding pocket with specific residues contributing differentially to various agonist interactions. Key residues S85(3.29) and Q175(5.40) show differential effects on receptor activation depending on the agonist used . To characterize this multi-agonist accommodation, researchers should employ:

    MethodologyApplicationKey Parameters
    Homology modeling and molecular dockingPredict binding modes for different agonistsBinding energy, interaction residues
    Site-directed mutagenesisValidate predicted binding residuesEC50 shifts, efficacy changes
    Structure-activity relationship studiesDefine pharmacophores for different agonist classesCore structural features, tolerant modifications
    Molecular dynamics simulationsExamine binding pocket flexibility and conformational statesBinding pocket volume, dynamic interactions
    Photoaffinity labelingDirectly identify contact residues with specific ligandsCovalent attachment sites

    These approaches, used in combination, can generate comprehensive maps of how different structural classes of bitter compounds interact with the same receptor binding pocket. Particular attention should be paid to residues that show ligand-specific effects when mutated, as these likely represent selective contact points for subsets of agonists.

  • What approaches can be used to investigate TAS2R10's potential role in ubiquitin-mediated proteolysis?

    Bioinformatics analyses have revealed a potential connection between TAS2R10 and ubiquitin-mediated proteolysis pathways, with identified interactions with ANAPC5 (Anaphase Promoting Complex Subunit 5) and ubiquitin protein ligase E3B . To investigate this non-canonical function, researchers should employ:

    First, validation of protein-protein interactions through co-immunoprecipitation of TAS2R10 with components of ubiquitin ligase complexes, followed by proximity ligation assays to confirm interactions in intact cells. The expression correlation between TAS2R10 and ANAPC5 observed in thyroid tissue provides a starting point . Second, functional assessment of ubiquitination activity in cells with modulated TAS2R10 expression, measuring global ubiquitination patterns by western blotting and mass spectrometry. Third, identification of specific substrates affected by TAS2R10 using stable isotope labeling with amino acids in cell culture (SILAC) combined with proteomics to compare protein turnover rates in TAS2R10-deficient versus wild-type cells. Fourth, mechanistic studies to determine if TAS2R10 activation by agonists modulates ubiquitination activity, potentially linking bitter compound sensing to protein degradation pathways. Finally, investigation of physiological consequences by examining cell cycle progression, protein quality control, and stress responses in models with altered TAS2R10 function, as these processes are tightly regulated by ubiquitin-mediated proteolysis.

  • How do mutations in TAS2R10 affect its response profile to different agonists and what does this reveal about receptor evolution?

    Mutations in TAS2R10 have demonstrated differential effects on agonist responses, with particularly notable impacts observed for residues S85(3.29) and Q175(5.40) . The observation that single point mutations can simultaneously improve responses to some agonists while decreasing activation by others suggests the binding site has evolved as a compromise solution to accommodate multiple agonists at the expense of optimal potency for individual compounds . Comparing TAS2R10 with the paralogous receptor TAS2R46, which also responds to strychnine, reveals they employ different binding modes despite recognizing the same agonist . This suggests independent acquisition of agonist specificities following gene duplication events.

    To investigate these evolutionary aspects, researchers should:

    1. Perform comprehensive mutational analysis with systematic substitutions at key positions, followed by functional characterization with a diverse panel of agonists

    2. Conduct phylogenetic analysis of TAS2R10 across species, correlating sequence variations with ecological niches and dietary patterns

    3. Reconstruct ancestral receptor sequences to experimentally test their response profiles, potentially revealing evolutionary trajectories

    4. Compare binding pocket architecture across TAS2R family members that differ in tuning breadth

    5. Use selection pressure analysis (dN/dS ratios) to identify residues under positive selection, which may represent adaptation to new ligands

    These approaches can reveal how natural selection has shaped TAS2R10's ligand recognition properties and provide insights into the molecular basis of taste perception evolution.

  • What methodologies are most effective for studying the potential involvement of TAS2R10 in Salmonella infection?

    The bioinformatic association between TAS2R10 and Salmonella infection represents an intriguing potential role for this receptor in host-pathogen interactions. To rigorously investigate this connection, researchers should employ a multi-faceted approach:

    First, establish cell culture infection models using epithelial cells (intestinal or respiratory) with modulated TAS2R10 expression levels through CRISPR knockout, siRNA knockdown, or overexpression. These models can be challenged with Salmonella to assess bacterial invasion efficiency, intracellular replication, and host cell responses. Second, mechanistic investigations should examine if TAS2R10 activation alters key cellular processes relevant to Salmonella pathogenesis, including cytoskeletal rearrangements, membrane trafficking, inflammatory signaling, or autophagy. Third, identification of potential Salmonella-derived TAS2R10 agonists should be performed, as bacterial metabolites might directly activate the receptor. Fourth, in vivo studies using TAS2R10-deficient mouse models challenged with Salmonella infection can establish physiological relevance, measuring bacterial burden, tissue pathology, and survival outcomes. Finally, translational studies examining TAS2R10 polymorphisms in human populations could identify associations with Salmonella susceptibility or disease outcomes, potentially establishing clinical relevance.

  • How can researchers investigate the tumor suppressor potential of TAS2R10?

    Previous studies have suggested a potential tumor suppressor role for TAS2R10 in neuroblastoma cells . To comprehensively characterize this function, researchers should implement a systematic research plan:

    First, analyze TAS2R10 expression across cancer databases (TCGA, CCLE) to identify cancer types with altered expression and correlate with patient outcomes. Second, perform functional studies in relevant cancer cell lines with modulated TAS2R10 expression, assessing hallmark cancer phenotypes including proliferation, apoptosis resistance, migration, invasion, and anchorage-independent growth. Third, investigate mechanistic pathways potentially linking TAS2R10 to tumor suppression, focusing on its involvement in cell cycle regulation (suggested by its association with cyclin binding ) and ubiquitin-mediated proteolysis pathways. Fourth, examine if TAS2R10 activation by agonists can directly influence cancer cell behavior, potentially identifying therapeutic applications. Fifth, develop in vivo tumor models with altered TAS2R10 expression to validate findings in physiologically relevant contexts. Sixth, analyze genetic alterations (mutations, copy number variations) of TAS2R10 in human tumors to identify potential inactivating mechanisms. This comprehensive approach can establish whether TAS2R10 functions as a genuine tumor suppressor and identify the underlying mechanisms.

  • What are the most effective experimental approaches for studying TAS2R10's role in smooth muscle relaxation?

    TAS2R10 has been implicated in relaxation of smooth muscle in multiple tissues, including ileum, airways, and blood vessels . These functions represent significant extra-oral roles with potential therapeutic applications. To effectively investigate these mechanisms, researchers should employ:

    Tissue SystemExperimental ApproachMeasurements
    Isolated smooth muscle stripsEx vivo organ bath studies with selective TAS2R10 agonistsForce generation, relaxation kinetics
    Primary smooth muscle cellsCalcium imaging with fluorescent indicatorsIntracellular calcium oscillations, calcium sensitivity
    Precision-cut tissue slicesLive tissue imaging with confocal microscopyContractile responses in native tissue architecture
    In vivo modelsPhysiological measurements following TAS2R10 agonist administrationBlood pressure, airway resistance, intestinal motility
    Mechanistic studiesPharmacological inhibition of downstream effectorsInvolvement of nitric oxide, BKCa channels, cAMP signaling

    Particular attention should be paid to signaling differences across tissue types, as TAS2R10-mediated relaxation may involve nitric oxide and BKCa channels in ileum , while affecting calcium oscillations and calcium sensitivity in airway smooth muscle . Understanding these tissue-specific mechanisms can inform potential therapeutic applications targeting TAS2R10 for disorders involving smooth muscle dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.