Recombinant Human Taste receptor type 2 member 14 (TAS2R14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
TAS2R14; Taste receptor type 2 member 14; T2R14; Taste receptor family B member 1; TRB1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISRISLVW LIFGSWCVSVFFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFL YLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASINGYRRNKTCSSDSSNFTRFSSLIV LTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKISGDASTKAHRGVKSVITFFLLY AIFSLSFFISVWTSERLEENLIILSQVMGMAYPSCHSCVLILGNKKLRQASLSVLLWLRY MFKDGEPSGHKEFRESS
Uniprot No.

Target Background

Function
This receptor potentially plays a role in the perception of bitterness and is linked to gustducin. It may contribute to sensing the chemical composition of gastrointestinal contents. Activation of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and subsequently lead to TRPM5 gating.
Gene References Into Functions
  1. We observed that individuals homozygous for the (G) allele of the TAS2R14-rs3741843 polymorphism exhibited reduced sperm progressive motility compared to heterozygotes and (A) homozygotes. PMID: 29040583
  2. Unlike in taste cells, our findings indicate that TAS2Rs primarily couple to the G proteins, Galphai1, Galphai2, and Galphai3, with no evidence of functional coupling to Galphagust. PMID: 28145731
  3. Heterologously expressed T2R14 responds to various flavones. These flavones also activate T2R14-driven calcium signals in primary cells, leading to nitric oxide production that enhances ciliary beating and mucociliary clearance. PMID: 28373278
  4. Our data suggest that the beta2AR acts as a double-edged sword: increasing TAS2R14 cell surface expression, but when activated by beta-agonist, partially counteracts this effect by direct receptor:receptor desensitization of TAS2R14 function. PMID: 27342779
  5. Probing the Binding Pocket of the Broadly Tuned Human Bitter Taste Receptor TAS2R14 by Chemical Modification of Cognate Agonists. PMID: 26825540
  6. TAS2R14 and TAS2R39 were activated by isoflavones and other isoflavonoids. PMID: 21942422
  7. These results suggest a potential mechanism by which Hoodia components might influence appetite control. The identified natural taste receptor antagonist warrants further investigation as an appetite suppressant. PMID: 20930049
  8. Our analysis revealed no statistically significant associations between polymorphisms in the TAS2R14 gene and colon cancer risk. PMID: 20534144

Show More

Hide All

Database Links

HGNC: 14920

OMIM: 604790

KEGG: hsa:50840

STRING: 9606.ENSP00000441949

UniGene: Hs.679406

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in testis.

Q&A

What is TAS2R14 and what distinguishes it from other bitter taste receptors?

TAS2R14 is one of 25 G protein-coupled receptors (GPCRs) in the human bitter taste receptor family. Unlike most other bitter taste receptors, TAS2R14 is highly "promiscuous," meaning it can recognize and respond to a remarkably wide variety of bitter substances, including vitamins, pharmaceutical compounds, and even some odorants . It is expressed at higher levels in non-oral tissues compared to the other 25 known bitter taste receptors and can recognize over 100 unique tastants . This exceptional binding versatility makes TAS2R14 a subject of particular interest in receptor biology research.

The receptor's structure includes both extracellular and newly discovered intracellular binding sites, which contribute to its ability to interact with such a diverse array of compounds. TAS2R14's distinctive binding properties suggest it may serve specialized physiological functions beyond traditional taste perception .

What are the primary experimental models used to study recombinant TAS2R14?

Researchers typically employ several complementary approaches to study recombinant TAS2R14:

  • Cell-based expression systems: Heterologous expression in HEK293 or CHO cell lines transfected with TAS2R14 genes, often co-expressed with chimeric G proteins to facilitate signaling detection.

  • Functional assays: Calcium imaging assays that measure intracellular calcium flux upon receptor activation, providing dose-response data for potential agonists .

  • Structural biology techniques: Cryo-electron microscopy (cryo-EM) has been successfully used to determine TAS2R14 structure at near-atomic resolution (2.7 to 2.9 Å), revealing critical binding domains and conformational states .

  • Computational modeling: Structure-based modeling and molecular docking studies, especially useful when integrated with experimental validation of predicted ligand interactions .

  • Site-directed mutagenesis: To identify critical residues involved in ligand binding and receptor activation .

These models have collectively advanced our understanding of both the structure and function of this versatile receptor, though each has specific limitations that researchers must consider when interpreting results.

What physiological roles has TAS2R14 been implicated in beyond taste perception?

TAS2R14 has been associated with several extra-oral functions:

  • Immune system modulation: TAS2R14 has been shown to mediate nitric oxide-driven endogenous innate immune responses and has been suggested as a potential target for treating airway infections .

  • Reproductive biology: The receptor is expressed in testis and spermatozoa, with potential implications for male fertility .

  • Metabolic sensing: Recent structural analyses suggest TAS2R14 may function as a sensor for cholesterol, bile acids, and other metabolites in non-oral tissues .

  • Inflammatory regulation: Natural TAS2R14 agonists from Radix Bupleuri have been shown to inhibit mast cell degranulation, suggesting a role in inflammatory processes .

  • Cancer biology: Expression patterns in certain cancer tissues suggest potential involvement in disease progression or response to treatment .

These diverse functions likely stem from TAS2R14's ability to detect and respond to endogenous signaling molecules beyond typical bitter compounds found in the diet.

How does the dual binding mechanism of TAS2R14 affect experimental approaches to studying receptor pharmacology?

The discovery of simultaneous binding at two distinct positions of TAS2R14—both extracellular and intracellular sites—represents a paradigm shift in receptor pharmacology approaches . This dual binding mechanism necessitates several methodological considerations:

  • Assay development: Researchers must develop site-specific binding assays to differentiate between the two binding domains. As noted in recent literature, "we have developed a new assay, which enables us to measure the binding specifically at the extracellular and the intracellular binding site, providing a unique tool for site-specific discovery" .

  • Pharmacological evaluation: Traditional dose-response curves may show complex kinetics that reflect cooperative binding between sites rather than simple one-site binding models. Analysis should incorporate potential allosteric interactions between the two binding pockets.

  • Ligand design: The dual binding mechanism creates opportunities for developing bispecific ligands that interact with both pockets simultaneously, potentially increasing specificity and efficacy.

  • Structural biology approaches: Cryo-EM and molecular dynamics simulations become particularly valuable for visualizing how simultaneous occupancy of both binding sites affects receptor conformation and activation state.

  • Mutagenesis strategies: Point mutations must be carefully planned to discriminate between effects on the extracellular versus intracellular binding sites.

This dual binding mechanism explains TAS2R14's exceptional promiscuity and requires researchers to develop more sophisticated experimental models than those typically used for single-binding-site receptors.

What are the critical considerations when designing structure-based virtual screening for novel TAS2R14 ligands?

When conducting structure-based virtual screening for TAS2R14 ligands, researchers should consider:

  • Model quality assessment: The quality of homology models is critical, especially since TAS2R14 has low sequence similarity to available experimental structures. Quality evaluation should include Ramachandran plots, ERRAT scores (with targets above 90 for high-quality models), and Z-score distributions .

  • Refinement iterations: Initial homology models require refinement based on experimental validation data. As observed in recent studies, "With the help of the derived structure-activity relationship analysis, the binding site of a low-resolution homology model was reshaped" , improving discrimination between active and inactive compounds.

  • Binding site flexibility: TAS2R14's binding pocket can accommodate a diverse range of molecules, particularly when modifications are in specific positions (e.g., meta-position tolerated, ortho-substitution not tolerated) . Modeling approaches should account for this conformational adaptability.

  • Critical interaction residues: Certain residues appear consistently important in binding studies, including:

    • Asn93 (hydrogen bonding)

    • Trp89, Phe186, Phe243, and Phe247 (hydrophobic interactions)

    • Ile148 and Ile262 (hydrophobic contacts)

  • Linker influence: Chemical modifications to linker regions between aromatic rings can dramatically affect activity by altering the relative orientation of key interacting groups .

The development of refined models has significantly improved virtual screening success rates, with one study reporting remarkable hit rates of approximately 55% (6 out of 11 designed compounds showing activity), despite starting from a very low-resolution homology model (~10% sequence identity to the template) .

How does cholesterol binding influence TAS2R14 structure and function in experimental systems?

Recent structural studies have revealed significant insights into cholesterol's role in TAS2R14 function:

  • Priming mechanism: Cholesterol binding at the cell-surface site of TAS2R14 appears to "prime" the receptor, placing it in a semi-active conformation that facilitates subsequent activation by small molecule ligands .

  • Partial activation: Importantly, cholesterol binding alone does not fully activate the receptor but creates a state of enhanced responsiveness to secondary ligands .

  • Structural basis: Cryo-EM studies have resolved how cholesterol interaction with TAS2R14 induces conformational changes that propagate through the receptor structure, preparing the intracellular signaling interface .

  • Experimental considerations: When studying TAS2R14 pharmacology, researchers must account for cellular cholesterol levels, as variations could lead to inconsistent activation responses between different experimental systems.

  • Physiological relevance: This cholesterol sensitivity suggests TAS2R14 may function as a metabolic sensor in extra-oral tissues, potentially detecting changes in cholesterol levels or cholesterol-derived compounds like bile acids .

These findings necessitate careful consideration of membrane composition in experimental systems, as cholesterol content could significantly influence observed receptor pharmacology and signaling outputs.

What are the optimal expression systems for producing functional recombinant TAS2R14?

Several expression systems have been successfully employed for TAS2R14 studies, each with specific advantages:

Expression SystemAdvantagesLimitationsApplications
HEK293T cellsHigh transfection efficiency; Mammalian post-translational processing; Compatible with most functional assaysLower protein yield compared to specialized systems; Endogenous GPCRs may complicate signaling studiesFunctional screening assays; Structure-activity relationship studies; Initial pharmacological characterization
Sf9 insect cellsHigher protein yields; Reduced mammalian GPCR background; Compatible with structural biology approachesDifferent membrane composition may affect receptor conformation; More complex culture requirementsProtein purification for structural studies; Large-scale production for biophysical analyses
Cell-free systemsRapid production; Direct access to reaction conditions; Avoiding cytotoxicity issuesMay lack proper folding for complex GPCRs; Limited post-translational modificationsInitial binding studies; High-throughput screening; Biosensor development

For optimal results, researchers should consider:

  • Codon optimization: Adapting the TAS2R14 coding sequence to the expression host can significantly improve yields.

  • Fusion partners: N-terminal tags (e.g., SNAP, FLAG) can improve expression while C-terminal modifications often preserve function better than N-terminal ones.

  • Signaling components: Co-expression with chimeric G proteins (such as Gα16gust44) enhances signaling detection in functional assays .

  • Membrane composition: Given TAS2R14's sensitivity to cholesterol, controlling membrane lipid composition is critical for consistent results .

The choice of expression system should be guided by the specific research question, with functional studies typically favoring mammalian systems and structural studies benefiting from systems optimized for protein yield.

What are the most reliable methods for measuring TAS2R14 activation in cellular assays?

Several methodologies have proven effective for detecting TAS2R14 activation:

  • Calcium mobilization assays:

    • Fluorescent calcium indicators (Fluo-4, Fura-2) provide robust signals

    • FLIPR (Fluorescent Imaging Plate Reader) platforms enable high-throughput screening

    • Data analysis should include both maximum response amplitude and activation kinetics

  • Bioluminescence resonance energy transfer (BRET):

    • Monitors G protein coupling or β-arrestin recruitment

    • Provides real-time kinetic information on receptor activation

    • Requires careful control constructs to account for non-specific interactions

  • Receptor internalization:

    • Fluorescently tagged TAS2R14 can be tracked for endocytosis upon activation

    • Confocal microscopy or high-content imaging provides quantitative data

    • Slower response than signaling assays but confirms functional activation

  • Novel site-specific binding assays:

    • Recently developed methods distinguish between extracellular and intracellular binding sites

    • Particularly important given TAS2R14's dual binding mechanism

For all assays, attention to methodological details is critical:

  • Full dose-response curves (not single concentrations) should be generated

  • EC50 values should be determined for comparative potency analysis

  • Appropriate positive controls (e.g., flufenamic acid) should be included

  • Negative controls should account for potential off-target activation

How can computational modeling approaches be integrated with experimental validation for TAS2R14 research?

An effective integrated approach to TAS2R14 research combines computational prediction with experimental validation in an iterative process:

  • Initial model development:

    • Begin with homology modeling despite low sequence identity (~10%) to available templates

    • Validate initial models through quality metrics including Ramachandran plots and ERRAT scores

    • Use existing experimental data to guide model refinement

  • Virtual screening:

    • Generate virtual combinatorial libraries of potential ligands

    • Dock compounds to identify candidates for synthesis and testing

    • Prioritize compounds based on predicted interactions with key residues (Asn93, Trp89, Phe186)

  • Experimental validation:

    • Synthesize top candidates identified through virtual screening

    • Test compounds in functional assays to determine EC50 values

    • Categorize compounds as active or inactive based on experimental results

  • Model refinement:

    • Use experimental activity data to refine the computational model

    • Apply induced-fit docking simulations to explore wider conformational space

    • Evaluate model performance using ROC curves to assess discrimination between active and inactive compounds

  • Iterative improvement:

    • Repeat the cycle with refined models to design next-generation compounds

    • Incorporate new structural data as it becomes available

    • Develop structure-activity relationships to guide further optimization

This approach has proven successful even with initially low-resolution models, with one study reporting: "The success of our model is remarkable: 6 out of 11 molecules suggested by the docking screening were confirmed as active compounds with EC50 values comparable or even superior to that of flufenamic acid" .

How does the newly discovered intracellular binding pocket of TAS2R14 change our understanding of bitter taste receptor activation?

The identification of an intracellular binding pocket in TAS2R14 represents a paradigm shift in our understanding of bitter taste receptor function:

  • Dual sensing capability: The receptor can simultaneously monitor both extracellular compounds (e.g., food-derived bitter molecules) and intracellular metabolites, suggesting an integrated sensing mechanism previously unrecognized in taste biology .

  • Signal integration: This architecture potentially allows TAS2R14 to integrate signals from both internal and external environments, functioning as a coincidence detector that responds differently when both sites are occupied versus single-site activation .

  • Novel activation mechanisms: The intracellular pocket may facilitate recognition of cytoplasmic signaling molecules or metabolites that modulate receptor activity independently of external tastants.

  • Structural implications: As Professor Niv explained, "It's fascinating because the receptor is not just sensing chemicals from outside the cell, like food or drugs, but also 'tasting' what's happening inside the cell" . This suggests a dynamic receptor that adapts its activity based on cellular state.

  • Pharmacological opportunities: The discovery creates new possibilities for designing drugs that selectively target either the extracellular or intracellular binding site, potentially allowing more precise modulation of receptor function .

This dual binding capability may explain TAS2R14's unusually broad responsiveness to diverse chemical structures and suggests it functions as more than a simple detector of external bitter compounds.

What structural elements determine the promiscuity of TAS2R14 compared to other bitter taste receptors?

TAS2R14's exceptional ligand promiscuity stems from several unique structural features:

  • Binding pocket architecture:

    • TAS2R14 possesses a particularly spacious orthosteric binding site with multiple sub-pockets

    • The receptor contains a distinctive arrangement of aromatic residues forming "three phenylalanine subpockets" (Phe186, Phe243, and Phe247) that provide versatile π-π interaction surfaces

    • The dual binding mechanism (extracellular and intracellular sites) effectively doubles the receptor's recognition capacity

  • Key flexible elements:

    • Molecular dynamics simulations suggest greater conformational flexibility in certain transmembrane regions compared to other TAS2Rs

    • This flexibility allows the receptor to adapt its binding pocket to accommodate structurally diverse ligands

    • Studies show that even large molecules can be accommodated if appropriately positioned, as "TAS2R14-binding pocket can accommodate large molecules"

  • Critical residues:

    • Asn93 (positioned at 3.36 using Ballesteros-Weinstein numbering) serves as a versatile hydrogen bonding partner

    • Trp89 (3.32) provides both hydrogen bonding capability and aromatic interactions

    • Ile148 (4.61) has been identified as "a TAS2R14 point contact specific for flufenamic acid recognition"

  • Linker accommodation:

    • The receptor shows specific preferences for certain chemical linkers between aromatic rings in ligands

    • NH-linkers are preferred over ether linkers or extended methylene units, as "a substantial decrease or even complete abolishment of TAS2R14 activity was observed when the amine linker was modified"

These structural elements collectively create a remarkably adaptable binding environment that explains TAS2R14's ability to recognize over 100 structurally diverse bitter compounds.

What is the current understanding of TAS2R14's conformational changes during receptor activation?

Recent structural and functional studies have begun to elucidate TAS2R14's activation mechanisms:

  • Priming by cholesterol:

    • Cholesterol binding at the cell-surface site induces a "semi-active state" that facilitates activation

    • This priming "enables more ready activation of the receptor by small molecules"

    • Importantly, cholesterol binding alone does not fully activate the receptor

  • Dual binding coordination:

    • When ligands like flufenamic acid (FFA) bind simultaneously at both extracellular and intracellular sites, they induce coordinated conformational changes

    • This dual occupation may produce distinct signaling outcomes compared to single-site binding

  • Transmembrane domain movements:

    • Cryo-EM studies at 2.7-2.9 Å resolution have revealed specific movements in transmembrane helices upon ligand binding

    • These movements propagate to the intracellular domains that interact with G proteins

  • G protein coupling interface:

    • The conformational changes expose interaction surfaces for G protein coupling

    • Unlike many GPCRs that couple primarily to one G protein family, TAS2R14 may couple to multiple G protein subtypes depending on activation state

  • Biased signaling potential:

    • The unusual dual binding mechanism suggests TAS2R14 may exhibit biased signaling, where different ligands or binding modes preferentially activate distinct downstream pathways

    • This hypothesis remains to be fully tested experimentally

Understanding these conformational dynamics is critical for developing targeted modulators of TAS2R14 function, particularly for potential therapeutic applications in non-taste tissues.

How can TAS2R14 research inform drug development for respiratory and inflammatory conditions?

TAS2R14 has emerging potential as a therapeutic target for several conditions:

  • Respiratory applications:

    • TAS2R14 has been "shown to mediate nitric oxide-driven endogenous innate immune responses and suggested as a target for treating airway infections"

    • Activation of bitter taste receptors in airway smooth muscle leads to bronchodilation, suggesting potential for asthma treatment

    • TAS2R14 agonists could provide novel mechanisms for addressing respiratory inflammation distinct from current therapies

  • Anti-inflammatory properties:

    • Research has identified "natural direct TAS2R14 agonists from Radix Bupleuri that can inhibit mast cell degranulation"

    • This mechanism offers potential approaches for treating allergic and inflammatory conditions

    • The newly discovered intracellular binding pocket may allow for developing drugs with reduced off-target effects on taste perception

  • Drug development strategies:

    • Structure-based design has successfully produced novel TAS2R14 agonists with improved potency over lead compounds

    • Bioisosteric replacement strategies have proven effective, as "using bioisosteric replacement, we could establish 5-substituted-1,2,3,4-tetrazoles as novel chemotypes for TAS2R14 ligands"

    • The refined structural models of TAS2R14 provide valuable tools for rational drug design

  • Pharmacological considerations:

    • Many approved drugs interact with TAS2R14, suggesting potential for drug repurposing

    • As noted in the literature, "TAS2R14 ligands are common among approved drugs and traditional Chinese medicines"

    • The promiscuity of TAS2R14 requires careful specificity screening when developing targeted therapeutics

The continued elucidation of TAS2R14 structure and function may lead to novel therapeutic approaches for respiratory and inflammatory conditions by leveraging this receptor's unique signaling properties.

What techniques are most effective for studying TAS2R14 expression and function in non-taste tissues?

Investigating TAS2R14 in extra-oral tissues requires specialized approaches:

TechniqueApplicationAdvantagesLimitations
qRT-PCRQuantifying TAS2R14 mRNA expression levels across tissuesHigh sensitivity; Specific quantification; Relatively simple protocolCannot confirm protein expression; No functional information; Requires careful primer design
Immunohistochemistry/ ImmunofluorescenceLocalizing TAS2R14 protein in tissue sectionsSpatial localization data; Cell-type specific information; Compatible with fixed tissue samplesAntibody specificity concerns; Semi-quantitative; Limited functional information
Western blottingConfirming TAS2R14 protein expressionProvides size verification; Semi-quantitative; Good for comparing expression levelsCannot provide subcellular localization; Requires specific antibodies; Limited functional information
RNA-seqComprehensive transcriptomic analysisUnbiased approach; Detects alternative splicing; Reveals co-expressed genesExpensive; Complex data analysis; Cannot confirm protein expression
Reporter cell assaysFunctional analysis in specific tissuesDirect measure of receptor activity; Can be adapted to primary cells; Quantitative readoutMay not reflect native signaling environment; Technical challenges with primary cells; Potential artifacts from reporter system
Tissue-specific knockout modelsIn vivo functional analysisPhysiological relevance; Reveals tissue-specific functions; Captures systemic effectsResource intensive; Potential developmental compensation; Technical challenges in generating models

Key considerations for non-taste tissue studies include:

  • Receptor trafficking: TAS2R14 may be localized differently in non-taste cells, requiring careful subcellular localization studies.

  • Signaling partners: The G protein coupling profile may differ between taste and non-taste tissues, necessitating comprehensive signaling pathway analysis.

  • Functional readouts: Tissue-specific endpoints (e.g., smooth muscle relaxation, immune cell activation) should be developed rather than relying solely on calcium signaling.

  • Physiological ligands: Identifying endogenous activators in specific tissues is critical, as these may differ from typical bitter tastants .

  • Expression levels: TAS2R14 is typically expressed at lower levels in non-taste tissues, requiring highly sensitive detection methods.

These methodological considerations are crucial for accurately characterizing TAS2R14's extra-oral functions and their potential therapeutic relevance.

How might understanding TAS2R14 structure-function relationships impact personalized medicine approaches?

The advancing knowledge of TAS2R14 structure and function has several implications for personalized medicine:

  • Genetic variation effects:

    • Single nucleotide polymorphisms (SNPs) in TAS2R14 may influence receptor function and ligand sensitivity

    • Knowledge of the critical binding residues allows prediction of how specific genetic variants might alter drug responses

    • Computational modeling approaches can simulate how TAS2R14 variants interact with potential therapeutics

  • Tissue-specific targeting:

    • The dual binding mechanism of TAS2R14 offers opportunities for tissue-selective drug action

    • As researchers noted, "By discovering this new pocket, we've opened the door to new ways of designing medications that target these receptors, potentially helping to treat conditions like asthma, obesity, and inflammation"

    • Drugs designed to preferentially bind either the extracellular or intracellular site might achieve tissue selectivity based on differential accessibility

  • Biomarker potential:

    • TAS2R14 expression patterns or activation states could serve as biomarkers for disease susceptibility or treatment response

    • Extra-oral expression particularly in immune and respiratory tissues suggests potential as a diagnostic indicator

  • Drug interaction prediction:

    • The promiscuity of TAS2R14 suggests it may be involved in unexplained drug effects or interactions

    • Structure-based screening could identify medications likely to interact with TAS2R14, allowing for personalized dosing adjustments

    • Computational models refined through experimental validation provide valuable tools for predicting individual drug responses

  • Nutritional personalization:

    • TAS2R14's role in detecting both dietary compounds and metabolites like bile acids suggests potential involvement in individual differences in nutrient sensing and metabolism

    • This could inform personalized dietary recommendations based on receptor variants

As structural and functional characterization of TAS2R14 continues to advance, these applications in personalized medicine are likely to expand, particularly in respiratory, immune, and metabolic conditions where the receptor has demonstrated physiological relevance.

What are the most promising approaches for resolving remaining questions about TAS2R14 structure and dynamics?

Several cutting-edge approaches hold promise for further elucidating TAS2R14 biology:

  • Advanced structural biology techniques:

    • Time-resolved cryo-EM to capture transient conformational states during activation

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions and conformational changes

    • Single-molecule FRET to observe real-time conformational dynamics in native-like environments

  • Integrated computational approaches:

    • Long-timescale molecular dynamics simulations to model complete activation pathways

    • Markov state modeling to identify key intermediates in the activation process

    • Machine learning approaches to predict ligand binding modes from limited experimental data

  • Novel biochemical tools:

    • Development of conformation-specific nanobodies or synthetic binding proteins as probes for specific receptor states

    • Photocrosslinking with novel unnatural amino acid incorporation to map binding interfaces

    • Engineered allosteric modulators to trap and study specific conformational states

  • Cellular signaling approaches:

    • CRISPR-based fluorescent reporters for real-time monitoring of TAS2R14 signaling in living cells

    • Proximity labeling methods (BioID, APEX) to identify context-specific interaction partners

    • Single-cell analysis techniques to reveal heterogeneity in receptor expression and function

These approaches, especially when used in combination, can address key questions including the precise sequence of conformational changes during dual-site binding, the stoichiometry of receptor-G protein interactions, and the structural basis for TAS2R14's exceptional promiscuity.

What challenges remain in translating TAS2R14 research to clinical applications?

Despite significant advances, several challenges impede clinical translation of TAS2R14 research:

  • Selectivity challenges:

    • TAS2R14's promiscuity complicates development of highly selective modulators

    • The receptor's ability to "recognize and respond to a wide variety of bitter substances, from vitamins to certain drugs and even odorants" creates potential for off-target effects

    • Cross-reactivity with other TAS2R family members requires careful compound optimization

  • Tissue-specific functions:

    • The differential roles of TAS2R14 across tissues are incompletely characterized

    • Therapeutic targeting requires better understanding of "physiological roles of bitter taste receptors that are expressed extraorally"

    • Context-dependent signaling may lead to unpredictable effects when targeting the receptor systemically

  • Pharmacokinetic considerations:

    • Achieving sufficient drug concentrations at intracellular binding sites poses delivery challenges

    • Compounds must penetrate cellular membranes while maintaining target specificity

    • Cholesterol-dependent receptor states add complexity to achieving consistent pharmacology in vivo

  • Biomarker development:

    • Clinical application requires validated biomarkers of TAS2R14 activity in target tissues

    • Non-invasive measurement methods need development for monitoring receptor engagement

    • Patient stratification strategies based on receptor variants or expression levels remain undefined

  • Regulatory pathway uncertainties:

    • Novel target class with limited precedent in drug approval pathways

    • Dual mechanism of action (bitter taste modulation plus extra-oral effects) complicates benefit-risk assessment

    • Safety concerns regarding potential effects on taste perception during chronic administration

Addressing these challenges requires continued fundamental research alongside translational studies that establish clear links between receptor modulation and disease-relevant endpoints.

How might emerging technologies advance high-throughput screening for novel TAS2R14 modulators?

Emerging technologies are transforming the discovery of TAS2R14 modulators:

  • Microfluidic platforms:

    • Droplet-based assays allow screening of compound libraries at dramatically reduced volumes

    • Integrated dose-response analysis enables rapid EC50 determination

    • Continuous flow systems permit kinetic analysis of receptor activation and desensitization

  • Advanced biosensor development:

    • FRET-based sensors enable real-time monitoring of receptor conformational changes

    • Engineered yeast or bacterial systems expressing TAS2R14 provide simplified screening platforms

    • Cell-surface display technologies allow direct binding measurements without requiring functional readouts

  • AI-enhanced virtual screening:

    • Deep learning models trained on existing TAS2R14 structure-activity data can predict novel actives

    • Generative models design compounds optimized for specific binding modes (extracellular vs. intracellular)

    • Integration with refined structural models significantly improves hit rates compared to traditional approaches

  • DNA-encoded libraries:

    • Ultra-large compound collections (>10^9 compounds) can be screened against purified receptor preparations

    • Selection-based approaches identify binders without requiring functional activity

    • Affinity-based ranking provides starting points for medicinal chemistry optimization

  • Organoid and ex vivo tissue platforms:

    • More physiologically relevant screening contexts that preserve tissue architecture

    • Multiplexed readouts that capture both on-target engagement and downstream physiological effects

    • Patient-derived screening systems that account for genetic and phenotypic diversity

These technologies address critical limitations in traditional screening approaches, potentially accelerating the discovery of selective TAS2R14 modulators with optimized pharmacological properties for specific therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.