Recombinant Human Taste receptor type 2 member 16 (TAS2R16)

Shipped with Ice Packs
In Stock

Description

Introduction to TAS2R16

TAS2R16 is a bitter taste receptor belonging to the TAS2R family of G protein-coupled receptors (GPCRs). It plays a critical role in detecting β-glucoside bitter compounds, such as salicin and amygdalin, which are found in plants and certain foods . Structurally, TAS2R16 consists of 291 amino acids with 7 transmembrane helices, 3 intracellular loops, and 3 extracellular loops . Its activation triggers a signaling cascade involving phospholipase C β2 (PLCβ2) and TRPM5 ion channels, leading to calcium flux and bitter perception .

Recombinant Production and Expression Systems

Recombinant TAS2R16 is produced in heterologous systems to study its structure, function, and ligand interactions. Key production methods include:

Expression SystemFeaturesApplicationsReferences
E. coliHigh yield, low costProtein purification, structural studies
Wheat germ in vitroNative folding preservationFunctional assays, ligand binding

Tags and Modifications:

  • N-terminal FLAG epitope and C-terminal V5 epitope tags are commonly used for tracking surface expression and full-length protein synthesis .

  • Recombinant TAS2R16 is often expressed without post-translational modifications, mimicking its native conformation .

Critical Residues and Ligand Specificity

Comprehensive mutagenesis studies identified 51 residues critical for TAS2R16 function. These include:

ResidueTransmembrane DomainRoleMutation EffectReferences
W261TM7Ligand-specific bindingW261A: Loss of function for salicin; gain of function for 4-nitrophenyl glycosides
N96TM1Probenecid resistanceN96T: 5-fold decrease in EC₅₀ for salicin and 4-NP-β-mannoside
F93TM1General signalingF93A: >50% reduction in activity for all ligands

Ligand Binding and Specificity

TAS2R16 accommodates diverse β-glycoside ligands through a two-faced binding pocket involving TM3 and TM7 . Key findings:

  • Sugar group orientation: 4-NP-β-mannoside (axial 2′-OH) activates TAS2R16 with a 4-fold lower EC₅₀ than 4-NP-β-glucoside (equatorial 2′-OH) .

  • R-group modifications:

    • Salicin (2-hydroxymethyl substitution) has a lower EC₅₀ than phenyl-β-D-glucoside .

    • 4-nitrophenyl glycosides show enhanced activation in W261A mutants due to altered binding modes .

Functional Assays

  • Ca²⁺ flux assays: Measure receptor activation via PLCβ2-TRPM5 signaling .

  • Immunofluorescence: Assess surface trafficking using FLAG/V5 tags .

  • ELISA: Detect TAS2R16 in biological samples (test range: 0.312–20 ng/ml) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TAS2R16; Taste receptor type 2 member 16; T2R16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQ WASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRW RILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQA HTVALVIPFILFLASTIFLMASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYF LTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
Uniprot No.

Target Background

Function
Gustducin-coupled receptor involved in the detection of bitter compounds within the oral cavity and gastrointestinal tract. It signals through PLCB2 and the calcium-activated cation channel TRPM5.
Gene References Into Functions
  1. While no significant association was found between sporadic colorectal cancer risk and selected SNPs, rs1525489 showed an association with increased rectal cancer risk (Ptrend = 0.0071) after stratification by histology (colon vs. rectum). PMID: 28915899
  2. Studies in Northern European, Maghreb, and Sri Lankan populations suggest that SNPs in TAS2R50 (rs1376251), TRPM5 (rs800345), and TAS2R16 (rs860170) are associated with dietary preferences. TAS2R16 (rs860170) shows strong population differentiation and correlates with salicin bitterness perception. (TRPM5 = transient receptor potential cation channel subfamily M member 5) PMID: 28366770
  3. Principal component analysis of binding energies for hT2R16 single-point mutants bound to an agonist correlated with experimental mutant cell responses. PMID: 25393978
  4. No significant association was found between rs702424 alleles and salicin bitter taste recognition, indicating this site does not contribute to salicin phenotypic variance. PMID: 24785689
  5. Individuals with at least one derived T-allele at polymorphic site 516 exhibit higher salicin bitterness sensitivity compared to those homozygous for the ancestral G-allele. PMID: 24177185
  6. Bitter taste receptor polymorphisms in TAS2R16 may be associated with human aging. PMID: 23133589
  7. This study discusses the association between the TAS2R16 gene and the evolution of bitter taste receptors across different populations. PMID: 21740153
  8. TAS2R16 is responsible for the perception of gentiobiose bitterness. PMID: 20965151
  9. This study details the molecular interaction between hTAS2R16 and beta-D-glucopyranoside. PMID: 20605788
  10. TAS2R16, located in taste receptor cells on the tongue, is activated by bitter beta-glucopyranosides and mediates bitter taste perception. PMID: 12379855
  11. A functional variant in the bitter-taste receptor hTAS2R16 influences alcohol dependence risk, particularly in African Americans. PMID: 16385453
  12. Functional variants in both TAS2R16 and TAS2R38 correlate with alcohol consumption in African-American families. PMID: 17250611
Database Links

HGNC: 14921

OMIM: 103780

KEGG: hsa:50833

STRING: 9606.ENSP00000249284

UniGene: Hs.272395

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a subset of gustducin-positive taste receptor cells of the tongue. Expressed in circumvallate papillae and testis.

Q&A

What is TAS2R16 and what is its primary function?

TAS2R16 is a member of the bitter taste receptor family (TAS2R), functioning as a G protein-coupled receptor (GPCR) that mediates bitter taste perception. It specifically responds to β-glucoside compounds, detecting approximately 30 different bitter compounds found in foods and potential toxins . TAS2R16 is primarily expressed in taste receptor cells but has also been identified in cells of the respiratory and gastrointestinal tracts . As part of the gustatory system, TAS2R16 helps organisms detect potentially harmful bitter compounds, translating that detection into perception via G protein-coupled signaling pathways .

How does TAS2R16 differ from other taste receptors structurally?

TAS2R16 belongs to the TAS2R family of bitter taste receptors, which are structurally distinct from sweet and umami receptors (T1R family) and salty taste receptors (ENaC family) . While T1R receptors contain seven transmembrane helices forming a heptahelical domain and a large extracellular N-terminus composed of a Venus flytrap module and a cysteine-rich domain , TAS2R16 demonstrates different structural characteristics. Critical residues in TAS2R16 predominantly cluster within the transmembrane (TM) domains, with the highest concentration in TM3 (9 residues) and TM5 (8 residues) . This distribution pattern is comparable to class A GPCRs, where these same helices undergo significant conformational changes upon activation .

What are the major ligands that activate TAS2R16?

TAS2R16 responds to approximately 30 different β-glucoside compounds . These compounds share a common molecular scaffold consisting of a D-glucose monosaccharide linked by an oxygen atom to a phenyl group . Specific ligands include:

  • Salicin (found in willow bark)

  • Phenyl-β-glucoside

  • 4-Nitrophenyl-β-glucoside (4-NP-β-glucoside)

  • 4-Nitrophenyl-β-mannoside (4-NP-β-mannoside)

Many plants, especially cruciferous vegetables such as broccoli and brussels sprouts, contain bitter β-glucosides like salicin, sinigrin, arbutin, and amygdalin that activate TAS2R16 . The receptor demonstrates different affinities for these compounds, with structural modifications affecting activation thresholds. For example, salicin, which differs from phenyl-β-D-glucoside solely by a 2-hydroxymethyl substitution on the R group, displays a considerably lower EC50 for TAS2R16 activation, suggesting this substitution confers a better fit for the binding pocket .

What residues are critical for TAS2R16 ligand binding and specificity?

Research using comprehensive mutation libraries has identified specific residues in TAS2R16 that are crucial for ligand binding and receptor specificity. A total of 13 residues have been identified that contribute to ligand-specific interactions, while 38 residues were found whose mutation eliminated signal transduction by all ligands tested .

These 13 ligand-specific residues are all positioned on the extracellular side of the transmembrane domains or in the extracellular loop (ECL) regions, consistent with the proposed location of ligand-binding sites in TAS2R receptors and other GPCRs . The data suggest a model in which hydrophobic residues on TM3 and TM7 form a broad ligand-binding pocket that can accommodate diverse structural features of β-glycoside ligands while still maintaining high specificity .

A particularly interesting example is residue W261, where the mutation W261A resulted in increased EC50 values (approximately 10-fold higher) for salicin and phenyl-β-glucoside but decreased EC50 values for 4-NP-β-mannoside and 4-NP-β-glucoside . This mutation demonstrates a gain-of-function for ligands with 4-nitrophenyl substitutions in the R-group but loss-of-function with other ligands, suggesting that the 4-nitrophenyl substitution exerts a major influence on ligand binding and may enable different modes of binding .

How do mutations affect TAS2R16 trafficking and signal transduction?

Comprehensive mutation analysis of TAS2R16 has revealed important insights into how mutations affect receptor trafficking and signaling. In mutation library studies:

  • 91% of mutant clones were fully expressed at >50% of wild-type levels

  • 88% of clones successfully trafficked to the cell surface at >50% of wild-type levels

  • 60% of clones signaled at >50% of wild-type levels

Only 17 TAS2R16 variants resulted in decreased surface trafficking while expressing at near wild-type levels, with most of these mutations (10 of 17) located in TM1 and TM2 . The majority of these mutations (11 of 17) were substitutions to arginine at positions in the transmembrane domains and, predictably, they reduced or eliminated both surface trafficking and calcium flux activities .

For receptor activation, a total of 39 positions in TAS2R16 showed significantly reduced activation by salicin without disrupting surface trafficking when substituted . Mapping of these critical residues revealed that 90% (35 of 39) cluster within the TM domains, with the highest incidence in TM3 (9 residues) and TM5 (8 residues) . This pattern is comparable to class A GPCRs, where these same helices undergo significant conformational changes upon activation .

How does TAS2R16 achieve both broad reactivity and high specificity?

TAS2R16 must accommodate a diverse range of β-glucoside structures while still maintaining specificity to prevent all foods from tasting bitter. The research data suggest a model for this balance:

The binding pocket of TAS2R16 has what could be described as a "two-faced" nature:

  • A broad, hydrophobic binding region (primarily involving residues on TM3 and TM7) that can accommodate diverse R-group structures of β-glycoside ligands

  • Specific interaction sites that ensure selectivity for the β-glycoside core structure

This arrangement allows TAS2R16 to recognize the common β-glycoside scaffold while accommodating various substitutions on the phenyl ring, explaining how the receptor can respond to approximately 30 different β-glucoside compounds while maintaining specificity .

The interaction requirements of the ligand-binding pocket residues enable TAS2R16 to maintain broad reactivity yet high specificity. Many of the critical residues identified are conserved among TAS2R family members, suggesting that the mechanisms used by TAS2R16 may also be applicable to other TAS2Rs .

What methods are most effective for studying TAS2R16 ligand interactions?

Several methodological approaches have proven effective for studying TAS2R16 ligand interactions:

  • Comprehensive mutation libraries: Creating systematic mutation libraries of TAS2R16 has been crucial for mapping interactions with agonists. This approach has successfully identified residues contributing to ligand specificity and signal transduction .

  • Calcium flux assays: Measuring intracellular Ca²⁺ flux in response to TAS2R16 activation has been effective for quantifying receptor activation. This method can identify critical mutations responsible for differential ligand responses .

  • Dose-response analyses: Conducting dose-response experiments with various ligands has revealed how specific substitutions within both the sugar and R group moieties affect TAS2R16 activation .

  • Epitope tagging: Using C-terminal V5 epitope tags to assess full-length translation and N-terminal FLAG epitope tags to evaluate surface expression has been valuable for distinguishing between trafficking defects and signaling defects in TAS2R16 variants .

When designing experiments to study TAS2R16 ligand interactions, researchers should consider using a combination of these approaches to obtain comprehensive data about binding properties, signaling capabilities, and structure-function relationships.

How can researchers effectively express and purify recombinant TAS2R16 for functional studies?

Producing functional recombinant TAS2R16 presents several challenges due to its membrane protein nature. Based on the available research, effective expression and purification strategies include:

  • Expression systems: Heterologous expression in HEK293 cells has been successfully used for TAS2R16 expression studies. This system allows for proper post-translational modifications and trafficking of the receptor to the cell surface .

  • Construct design: Including epitope tags (such as V5 or FLAG) can facilitate detection and purification while enabling validation of full-length translation and surface expression .

  • Expression verification: Using dual-verification methods to assess both total expression (via C-terminal tags) and surface expression (via N-terminal tags) is critical for distinguishing between expression defects and trafficking defects .

  • Functional validation: Calcium mobilization assays using fluorescent calcium indicators provide a reliable readout of receptor functionality after expression .

When designing expression constructs, researchers should consider that approximately 91% of TAS2R16 variant clones achieve full translation (>50% of wild-type levels), and 88% successfully traffic to the cell surface (>50% of wild-type levels), suggesting that most mutations do not catastrophically affect expression or trafficking .

What are the most informative genetic variants of TAS2R16 for structure-function studies?

Several genetic variants of TAS2R16 have proven particularly informative for structure-function studies:

  • W261A variant: This mutation shows a fascinating reversal of activity, with decreased activation by salicin and phenyl-β-glucoside but increased activation by 4-NP-β-mannoside and 4-NP-β-glucoside. This variant demonstrates how a single residue can dictate ligand specificity and suggests different binding modes for different ligands .

  • N96T variant: This naturally occurring variant found in non-primate species decreases the EC50 for TAS2R16 activation by both salicin and 4-NP-β-mannoside by approximately 5-fold. The equivalence of the effect on both ligands suggests this mutation acts independently of ligand type or is mediated by interactions conserved between molecules .

  • Ligand-specific variants: The 13 identified residues that contribute to ligand-specific interactions provide a valuable resource for understanding the molecular basis of TAS2R16 specificity. Mutations at these positions result in differential effects on different ligands, making them excellent targets for structure-function studies .

A table summarizing some key informative variants:

VariantEffect on SalicinEffect on 4-NP-β-mannosideStructural Insight
W261A~10-fold higher EC50Decreased EC50 (stronger activation)Critical for distinguishing ligands with 4-nitrophenyl substitutions
N96T~5-fold lower EC50~5-fold lower EC50Evolutionarily variable position that affects receptor sensitivity regardless of ligand

These variants offer valuable tools for probing the structural basis of TAS2R16 function and specificity.

What is known about associations between TAS2R16 variants and disease susceptibility?

Recent research has begun to explore potential associations between TAS2R16 genetic variants and disease states. A 2024 study investigated the association between TAS2R16 gene variants (rs860170, rs978739, rs1357949), TAS2R16 serum levels, and multiple sclerosis (MS) . The study found that the TAS2R16 rs860170 TT genotype was statistically significantly associated with multiple sclerosis .

This emerging research direction suggests that TAS2R16, previously studied primarily for its role in taste perception, may have broader physiological functions and disease associations. Given that TAS2R16 is expressed not only in taste receptor cells but also in cells of the respiratory and gastrointestinal tracts , these receptors may play roles beyond taste perception that could influence disease susceptibility.

How can researchers measure TAS2R16 expression and activity in patient samples?

Based on current research approaches, the following methods can be used to measure TAS2R16 expression and activity in patient samples:

  • Genotyping: Single nucleotide polymorphisms (SNPs) in the TAS2R16 gene can be tested using real-time polymerase chain reaction (RT-PCR), as demonstrated in the 2024 study on multiple sclerosis patients .

  • Protein quantification: Serum concentration of TAS2R16 can be measured using enzyme-linked immunosorbent assay (ELISA) methods .

  • Expression analysis: For tissue samples, immunohistochemistry or in situ hybridization can be used to detect TAS2R16 expression in specific cell types.

  • Functional assays: For ex vivo studies, calcium mobilization assays using patient-derived cells could potentially measure receptor functionality in response to known TAS2R16 agonists.

When designing patient-oriented studies involving TAS2R16, researchers should consider both genetic variation (through SNP analysis) and protein expression levels, as both may contribute to disease associations or phenotypic differences.

What therapeutic potential might targeting TAS2R16 offer for metabolic or neurological conditions?

While research on the therapeutic potential of targeting TAS2R16 is still in its early stages, several avenues merit exploration:

  • Metabolic disorders: Given that TAS2R16 responds to compounds found in many cruciferous vegetables , which are known to have metabolic benefits, there may be connections between TAS2R16 signaling and metabolic regulation. Understanding these connections could potentially lead to novel therapeutic approaches for metabolic disorders.

  • Neurological conditions: The recent association between TAS2R16 variants and multiple sclerosis suggests potential neurological implications of TAS2R16 function. Further research may reveal whether modulating TAS2R16 activity could influence neuroinflammatory processes.

  • Gastrointestinal function: Since TAS2R16 is expressed in the gastrointestinal tract , it may play roles in gut function, enteroendocrine signaling, or gut-brain communication. These functions could potentially be targeted therapeutically.

Researchers interested in exploring the therapeutic potential of TAS2R16 should focus on:

  • Further elucidating the extra-oral functions of TAS2R16

  • Identifying endogenous ligands beyond dietary compounds

  • Developing selective agonists or antagonists that could modulate TAS2R16 activity

  • Investigating downstream signaling pathways that might connect TAS2R16 activation to physiological outcomes

How does TAS2R16 structure and function vary across species?

While the search results don't provide comprehensive data on TAS2R16 across species, we can draw some insights from the information about taste receptors in general. The bitter taste receptor family shows considerable variation across species, reflecting evolutionary adaptation to different dietary niches and exposure to different potential toxins.

One specific example mentioned in the search results concerns position 96 in TAS2R16. A comparison of TAS2R16 sequences across species showed that asparagine is found at position 96 only in higher primates, while in other organisms, position 96 is occupied by threonine . This variation affects receptor function, as the N96T mutation decreased the EC50 for TAS2R16 activation by both salicin and 4-NP-β-mannoside by approximately 5-fold . This suggests that threonine at position 96 results in greater sensitivity for TAS2R16 ligands .

In contrast to the variation seen in TAS2R16, it's worth noting that some taste receptor genes show more dramatic evolutionary changes, including complete loss in some species. For example, the sweet taste receptor gene Tas1r2 is absent in chickens, zebra finch, and horses, and is a pseudogene in several carnivorous species including cats, tigers, and hyenas . This reflects the lack of evolutionary pressure to maintain sweet taste detection in obligate carnivores or granivores .

What methods are most effective for comparative analysis of TAS2R16 across species?

For researchers interested in conducting comparative analyses of TAS2R16 across species, several methodological approaches would be most effective:

  • Sequence analysis: Comparative genomics approaches can identify orthologous TAS2R16 genes across species and analyze evolutionary conservation or divergence at specific residues. This approach has already revealed functional differences, such as the N96T variation between primates and other mammals .

  • Functional characterization: Heterologous expression of TAS2R16 from different species, followed by calcium mobilization assays with a panel of potential ligands, can reveal functional differences in receptor activation profiles.

  • Site-directed mutagenesis: Introducing species-specific amino acid changes into human TAS2R16 can help identify the specific residues responsible for functional differences between species, as demonstrated with the N96T mutation .

  • Evolutionary analysis: Calculating selection pressures (dN/dS ratios) across the TAS2R16 sequence can identify regions under positive or purifying selection, providing insights into evolutionary adaptation.

When conducting comparative studies, researchers should focus particularly on residues known to be critical for ligand binding and specificity, as these may show the most meaningful variation across species adapted to different dietary niches.

What are the most promising areas for future TAS2R16 research?

Based on the current state of knowledge, several promising areas for future TAS2R16 research emerge:

  • Structural biology: While the search results provide insights into critical residues for TAS2R16 function, a high-resolution crystal or cryo-EM structure would significantly advance understanding of the receptor's binding mechanism and conformational changes during activation.

  • Extraoral functions: Further investigation of TAS2R16 expression and function in tissues beyond the oral cavity, particularly in the respiratory and gastrointestinal tracts, could reveal novel physiological roles.

  • Disease associations: Building on the recent finding of an association between TAS2R16 variants and multiple sclerosis , more comprehensive studies of TAS2R16 in various disease states could uncover new clinical relevance.

  • Signaling pathways: Detailed characterization of the downstream signaling pathways activated by TAS2R16 in different cell types could reveal tissue-specific functions and potential therapeutic targets.

  • Endogenous ligands: While TAS2R16 is known to respond to plant-derived β-glucosides, investigation of potential endogenous ligands could reveal unexpected physiological roles.

Each of these research directions has the potential to significantly expand our understanding of TAS2R16 beyond its established role in bitter taste perception.

What technological advances would most benefit TAS2R16 research?

Several technological advances would particularly benefit future TAS2R16 research:

  • Improved membrane protein structural biology techniques: Advances in cryo-EM, lipid cubic phase crystallization, or computational structure prediction (building on AlphaFold advances) could help overcome the challenges of determining the structure of this membrane protein.

  • Single-cell transcriptomics and proteomics: These technologies could provide higher-resolution data on TAS2R16 expression patterns across tissues and cell types, potentially revealing unexpected sites of expression.

  • CRISPR-based genome editing: Precise manipulation of TAS2R16 in model organisms or human organoids could facilitate functional studies of receptor variants identified in human populations.

  • Advanced biosensors: Development of improved sensors for detecting TAS2R16 activation in real-time in living cells or tissues would facilitate functional studies and screening of potential ligands.

  • Computational ligand prediction: Advances in computational methods for predicting ligand-receptor interactions could accelerate the discovery of novel TAS2R16 ligands, both synthetic and potentially endogenous.

Researchers planning future studies on TAS2R16 should consider incorporating these technological approaches to address current knowledge gaps and overcome methodological limitations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.