Recombinant Human Taste receptor type 2 member 39 (TAS2R39)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

Recombinant TAS2R39 fragments (e.g., aa 6-31) are used as controls in antibody validation and functional assays. Key production details:

  • Expression systems: Commonly produced in E. coli for antigen generation .

  • Applications:

    • Blocking experiments with antibodies (e.g., PA5-62792) in Western blot (WB) and immunohistochemistry (IHC) .

    • Study of receptor-ligand interactions using structure-activity relationship (SAR) models .

Functional Roles in Physiology

TAS2R39 exhibits broad tissue distribution and diverse roles:

Gastrointestinal tract:

  • Modulates enterohormones (e.g., ghrelin, cholecystokinin) to regulate food intake .

  • Detects dietary bitter compounds like green tea catechins and soy isoflavones .

Respiratory system:

  • Linked to allergic rhinitis congestion and inflammatory cytokine release .

Nervous system:

  • Detected in choroid plexus cells, suggesting potential roles in neuroprotection .

Agonists

Compound ClassExamplesActivation ThresholdSource
Plant polyphenolsTheaflavins, catechinsLow µM range
Bile acidsTaurocholic acid3 µM
PeptidesD-Trp, Trp-Trp dipeptidesLow efficacy

Antagonists

  • Flavones: Inhibit receptor activation by blocking conformational changes .

Comparative Analysis with Orthologs

TAS2R39 activation profiles differ significantly from mouse orthologs:

SpeciesOrthologBile Acid ResponseKey Agonist Specificity
HumanTAS2R39Strong (e.g., TCA)Ursodeoxycholic acid (3 µM)
MouseTas2r139Non-responsiveAbsent for ursodeoxycholic acid

Sequence divergence in TMD regions explains species-specific ligand preferences .

Future Research Directions

  • Structural studies: High-resolution crystallography to refine binding dynamics .

  • Therapeutic potential: Targeting TAS2R39 for metabolic disorders or airway inflammation .

  • Signaling pathways: Elucidating downstream mechanisms in extraoral tissues .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to bring the contents to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specified tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R39; Taste receptor type 2 member 39; T2R39; Taste receptor type 2 member 57; T2R57
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHA AEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFL NFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINIC TVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTL HMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIM AAYPASHSILLIQDNPGLRRAWKRLQLRLHLYPKEWTL
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is gustducin-linked. It might also contribute to sensing the chemical composition of gastrointestinal contents. The activity of this receptor could stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Gene References Into Functions
  1. hTAS2R39 is the primary receptor for the bitterness of theaflavins. PMID: 25273142
  2. TAS2R14 and TAS2R39 were activated by isoflavones and other isoflavonoids. PMID: 21942422
  3. Human bitter taste receptors hTAS2R8 and hTAS2R39 display differential functions in recognizing bitter peptides. PMID: 21670512
  4. These results suggest the participation of hTAS2R39 in the detection of catechins in humans. PMID: 21272567
Database Links

HGNC: 18886

KEGG: hsa:259285

STRING: 9606.ENSP00000405095

UniGene: Hs.553660

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.

Q&A

What is TAS2R39 and how does it compare structurally to other bitter taste receptors?

TAS2R39 is a G protein-coupled receptor belonging to the T2R bitter taste receptor family. It consists of 338 amino acids arranged in seven transmembrane domains (numbered I through VII), which is typical of the GPCR superfamily. The receptor's binding pocket is located extracellularly between transmembrane helices III, V, VI, and VII, with hydrophobic interactions constituting the majority of the binding interface. Hydrogen bond acceptors and donors also contribute significantly to ligand binding, with potential π-π aromatic interactions occurring within the binding pocket .

Compared to other bitter taste receptors, TAS2R39 demonstrates distinctive genetic characteristics. It exhibits the lowest nucleotide diversity (π = 0.005%) among the 23 TAS2R genes studied, falling below the 5th percentile of the genome-wide empirical distribution . This unusually low genetic diversity suggests that TAS2R39 may be under strong purifying selection, potentially indicating its essential biological function beyond taste perception.

Where is TAS2R39 expressed in human tissues and what are its primary functions?

While initially discovered in taste buds, TAS2R39 expression extends well beyond the oral cavity. Research has confirmed its presence in the:

  • Gastrointestinal tract

  • Respiratory system

  • Nervous system

  • Reproductive system

How does TAS2R39 differ from other TAS2Rs in terms of genetic diversity and population differentiation?

TAS2R39 stands out among bitter taste receptors for its remarkably low genetic diversity. With a nucleotide diversity (π) of 0.005%, it falls below the 5th percentile of the genome-wide empirical distribution, making it an outlier even among other TAS2Rs, which show a mean π value of 0.12% . This exceptionally low diversity suggests strong evolutionary constraints on TAS2R39.

In terms of population differentiation, TAS2R39 shows a FST value of 0.01, which is notably lower than the average FST of 0.13 across TAS2R genes. This value places TAS2R39 at the 2.6th percentile (PE = 0.026) of the genomic distribution, indicating unusually low differentiation between populations . The combination of low diversity within populations and low differentiation between populations suggests that TAS2R39 function may be highly conserved across human populations, potentially due to its importance in detecting specific compounds relevant to human health regardless of geographical location.

What types of compounds are known to activate TAS2R39?

TAS2R39 is characterized as a relatively non-selective receptor, responding to a diverse array of mostly plant-derived compounds. Key agonists include:

  • Theaflavins (particularly theaflavin and theaflavin-3,3-O'-digallate from black tea)

  • Catechins

  • Isoflavones (including acetylgenistin, genistin, glycitin, and malonyl genistin)

  • Various flavonoids (acacetin, 5,2′-dihydroxyflavone, gardenin A, genkwanin, gossypetin, 6-methoxyflavonol, and 4′-hydroxyflavanone)

  • Vanillin

  • Specific dipeptides (Trp-Trp and Leu-Trp) and tripeptides (Trp-Trp-Trp and Leu-Leu-Leu)

Interestingly, TAS2R39 demonstrates selectivity even within similar compound classes. For example, it responds to certain Trp-containing dipeptides (Trp-Trp) but not others (Trp-Leu), indicating that ligand recognition extends beyond simply identifying specific amino acids and likely involves precise structural conformations .

What structural characteristics are required for compounds to act as TAS2R39 antagonists?

While most identified ligands for TAS2R39 are agonists, researchers have discovered some antagonists belonging to the flavanone group. The key structural requirements for TAS2R39 antagonism include:

  • A mandatory methoxy group on position 6 of the A ring

  • The absence of a double bond in the C ring of the structure

Specifically, 6,3'-dimethoxyflavanone and 4'-fluoro-6-methoxyflavanone demonstrated strong inhibiting tendencies against TAS2R39, while 6-methoxyflavanone showed weaker inhibition. These antagonists also exhibited some inhibitory activity against TAS2R14, though to a lesser extent than against TAS2R39, highlighting the challenge of developing truly selective antagonists for individual TAS2Rs .

How does the ligand binding mechanism of TAS2R39 compare with other bitter taste receptors?

Comparative analyses between TAS2R39 and other bitter taste receptors, particularly TAS2R14, have revealed both similarities and differences in ligand binding mechanisms. One notable distinction concerns glycosylation effects: glycosylation inhibits TAS2R14 activation but only reduces TAS2R39 sensitivity without preventing activation altogether. This suggests different structural constraints in the binding pockets of these receptors .

For TAS2R39 ligands, substitutes (preferably hydroxy groups) are obligatory for binding activity. Modifications to the C-ring skeletal structure of isoflavonoid compounds do not prevent activation of either TAS2R14 or TAS2R39, though they may alter potency and efficacy .

The specificity profile of TAS2R39 places it in the middle of the selectivity spectrum among bitter taste receptors. Some TAS2Rs like TAS2R46 respond to numerous compounds (up to 19 of 58 tested compounds), while others like TAS2R3, TAS2R5, and TAS2R9 showed no response to any of the 58 diverse compounds in a comprehensive screening study . TAS2R39's moderate selectivity suggests it evolved to detect a specific but still relatively broad range of potentially harmful compounds.

What are the recommended approaches for studying TAS2R39 expression in different tissues?

For researchers investigating TAS2R39 expression across different tissues, a multi-method approach is recommended:

  • Quantitative RT-PCR: Provides sensitive quantification of TAS2R39 mRNA levels using receptor-specific primers carefully designed to avoid cross-reactivity with other TAS2Rs due to sequence homology.

  • Immunohistochemistry/Immunofluorescence: Enables localization of TAS2R39 protein within tissues and at the cellular level. When using antibodies, thorough validation is essential due to potential cross-reactivity issues between bitter taste receptors.

  • Single-cell RNA sequencing: Offers high-resolution analysis of TAS2R39 expression at the single-cell level, allowing identification of specific cell types expressing the receptor within heterogeneous tissues.

  • Western blotting: Provides confirmation of protein expression and can be used to compare expression levels across different tissues when combined with appropriate loading controls.

When interpreting expression data, researchers should be aware that TAS2R39 expression levels can vary significantly between tissues, with extraoral sites often showing lower expression compared to taste buds. Careful selection of reference genes and multiple technical and biological replicates are necessary to obtain reliable results .

How can researchers functionally characterize recombinant TAS2R39 in vitro?

Functional characterization of recombinant TAS2R39 typically employs heterologous expression systems combined with downstream signaling assays:

  • Expression system selection: HEK293T or HEK293 cells are commonly used for TAS2R39 expression due to their ease of transfection and low endogenous expression of taste receptors. For more physiologically relevant systems, researchers may consider immortalized taste bud-derived cell lines.

  • Calcium imaging assays: Since TAS2R39 activation leads to increased intracellular calcium, fluorescent calcium indicators (such as Fura-2, Fluo-4, or genetically encoded calcium indicators) can be used to monitor receptor activation in real-time.

  • FLIPR (Fluorescent Imaging Plate Reader) assays: Enables high-throughput screening of potential TAS2R39 ligands by measuring calcium flux across multiple samples simultaneously.

  • Reporter gene assays: Utilizing constructs where TAS2R39 activation leads to quantifiable reporter expression (e.g., luciferase) provides an alternative measure of receptor functionality.

  • Bioluminescence resonance energy transfer (BRET) or Förster resonance energy transfer (FRET): These approaches can directly measure conformational changes in the receptor upon ligand binding.

When conducting functional studies, it's crucial to include both positive controls (known TAS2R39 agonists like theaflavins) and negative controls (compounds known not to activate TAS2R39). Dose-response curves should be generated to determine EC50 values, which can then be compared across different ligands to assess relative potency .

What approaches are recommended for identifying new ligands for TAS2R39?

Discovering novel TAS2R39 ligands requires a combination of computational and experimental approaches:

  • Structure-based virtual screening: Using the pharmacophore model of TAS2R39's binding pocket, researchers can virtually screen large compound libraries to identify potential ligands. The model suggests focusing on compounds that can form hydrophobic interactions with the binding pocket between transmembrane helices III, V, VI, and VII, with additional hydrogen bond acceptors and donors .

  • High-throughput functional screening: Testing libraries of compounds, particularly plant-derived molecules, using calcium imaging or other functional assays to identify those that activate TAS2R39.

  • Natural product fractionation: Given that many known TAS2R39 ligands are plant-derived, fractionation of natural product extracts followed by bioactivity testing represents a valuable approach for discovering novel agonists.

  • Structural analogue testing: Synthesizing and testing structural analogues of known TAS2R39 ligands (like theaflavins and flavonoids) with systematic modifications to establish structure-activity relationships.

  • Cross-receptor comparison: Screening compounds known to activate related bitter taste receptors, particularly TAS2R14, which shares some ligands with TAS2R39.

When identifying new ligands, researchers should confirm specificity by testing candidates against multiple TAS2Rs, as many bitter compounds activate multiple receptors with varying potencies .

How does genetic variation in TAS2R39 impact receptor function and what are the health implications?

Despite TAS2R39 showing remarkably low nucleotide diversity (π = 0.005%) compared to other bitter taste receptors , the genetic variations that do exist may have significant functional consequences. Current research suggests:

  • Functional impact: Nonsynonymous variants in TAS2R39 may alter receptor sensitivity to specific ligands or change signal transduction efficiency. These variations could potentially explain individual differences in bitter taste perception, particularly for compounds specifically detected by TAS2R39.

  • Population differences: The low FST value (0.01) for TAS2R39 indicates minimal population differentiation , suggesting that any functional variants are likely to be either globally distributed or very rare. This contrasts with receptors like TAS2R38, which shows well-documented population differences in functionality.

  • Health implications: Given TAS2R39's expression in extraoral tissues and its potential role in detecting compounds with pharmacological activity (such as theaflavins and catechins), genetic variants might influence:

    • Gastrointestinal hormone regulation and food intake

    • Respiratory responses to environmental compounds

    • Individual variations in the therapeutic effects of plant-derived compounds that interact with TAS2R39

Researchers investigating these relationships should employ genomic sequencing to identify variants, functional assays to characterize their effects on receptor activity, and population studies to correlate genotypes with phenotypic differences in taste perception or physiological responses .

What are the challenges in developing selective agonists and antagonists for TAS2R39?

Developing compounds that selectively target TAS2R39 presents several significant challenges:

  • Structural similarity among TAS2Rs: The high sequence homology among bitter taste receptors means that compounds targeting one receptor often interact with others. This is evidenced by the observation that antagonists of TAS2R39 also show some inhibitory activity against TAS2R14, albeit with lower potency .

  • Limited structural information: Despite computational modeling, the lack of crystal structures for TAS2Rs hampers structure-based drug design. Current pharmacophore models rely heavily on homology modeling and in silico predictions.

  • Ligand promiscuity: Many bitter compounds activate multiple TAS2Rs with varying potencies. For example, while some isoflavones specifically activate TAS2R39 (acetylgenistin, genistin, glycitin, and malonyl genistin), others activate both TAS2R39 and TAS2R14 .

  • Stereochemical considerations: Research suggests that antagonists display stereochemical flexibility that fills the binding pocket and prevents conformational changes required for receptor activation . Engineering this precise property while maintaining selectivity requires sophisticated medicinal chemistry approaches.

  • Validation complexity: Confirming selectivity requires testing candidates against all 25 human TAS2Rs, a resource-intensive process rarely completed comprehensively.

To address these challenges, researchers should systematically explore structure-activity relationships of known TAS2R39 ligands, focusing on the specific structural features (like the mandatory methoxy group on position 6 of the A ring for antagonists) that confer TAS2R39 selectivity .

What current evidence supports the physiological roles of TAS2R39 beyond taste perception?

The extraoral expression of TAS2R39 suggests physiological functions beyond bitter taste perception. Current evidence supports several potential roles:

  • Gastrointestinal function: TAS2R39 expression in the gastrointestinal tract suggests involvement in nutrient sensing and hormone secretion. Some evidence indicates it may regulate enterohormones and consequently influence food intake, potentially contributing to satiety signaling after consumption of foods containing TAS2R39 agonists .

  • Respiratory system: TAS2R39 in the respiratory system may participate in detecting inhaled compounds. Research suggests it might be involved in congestion processes during allergic rhinitis and could stimulate inflammatory cytokine production. This implies a potential role in innate immunity and inflammatory responses in the airway .

  • Cellular defense mechanisms: Like other bitter taste receptors, TAS2R39 may function as a cellular defense mechanism against toxic compounds. Its ability to detect plant-derived compounds with potential toxicity suggests an evolutionary role in protecting the organism from harmful substances.

  • Metabolic regulation: The interaction of TAS2R39 with food-derived compounds like theaflavins and catechins implies possible roles in metabolic regulation, particularly given the putative health benefits associated with many of these compounds.

Research into these physiological roles is still emerging, and scientists should employ tissue-specific knockout models, selective agonists/antagonists, and comprehensive physiological readouts to further elucidate the full functional repertoire of TAS2R39 .

How should researchers interpret genetic diversity data for TAS2R39?

The unusual genetic characteristics of TAS2R39—particularly its low nucleotide diversity (π = 0.005%) and low population differentiation (FST = 0.01) —present unique interpretation challenges:

What methodological approaches should be used to characterize TAS2R39 signaling pathways?

Elucidating TAS2R39 signaling pathways requires a comprehensive set of methodological approaches:

  • G-protein coupling analysis: TAS2Rs typically couple to gustducin (Gαgust), but they may interact with other G-proteins in different tissues. Researchers should use:

    • Coimmunoprecipitation to identify physical interactions

    • BRET/FRET to measure dynamic coupling upon ligand binding

    • G-protein selective inhibitors to dissect pathway components

    • siRNA knockdown of specific G-proteins to confirm their involvement

  • Second messenger characterization: TAS2R39 activation typically leads to PLC-β2 stimulation and subsequent calcium release. Researchers should measure:

    • IP3 production

    • Calcium flux using fluorescent indicators

    • PKC activation

    • Potential cAMP modulation

  • Downstream signaling effects: Beyond immediate second messengers, researchers should investigate:

    • MAPK pathway activation

    • Gene expression changes using RNA-Seq or qPCR arrays

    • Functional cellular responses (e.g., hormone release, antimicrobial peptide production)

  • Tissue-specific pathway variations: Importantly, signaling cascades may differ between tissues. Comparing pathways in taste cells versus respiratory or gastrointestinal cells can provide insights into tissue-specific functions of TAS2R39 .

  • Potential receptor interactions: Investigating whether TAS2R39 forms heterodimers with other receptors, which might influence signaling outcomes, using approaches like proximity ligation assays or co-immunoprecipitation.

How can researchers address potential cross-reactivity issues when studying TAS2R39?

Cross-reactivity presents significant challenges in TAS2R39 research, both at the level of receptor detection and functional characterization:

  • Antibody validation strategies:

    • Validate commercial antibodies using TAS2R39 knockout/knockdown models

    • Perform peptide competition assays to confirm specificity

    • Compare staining/detection patterns across multiple antibodies targeting different epitopes

    • Use tagged recombinant TAS2R39 as positive controls

  • Genetic approaches to ensure specificity:

    • Employ CRISPR-Cas9 to generate TAS2R39-specific knockouts

    • Use siRNA with carefully designed sequences unique to TAS2R39

    • Validate knockdown/knockout specificity by measuring expression of other TAS2Rs

  • Pharmacological specificity:

    • Test compounds against multiple TAS2Rs in parallel

    • Use structure-activity relationship studies to identify TAS2R39-specific pharmacophores

    • Develop and validate negative control compounds structurally similar to agonists but lacking activity

  • Control for endogenous expression:

    • Characterize the endogenous expression profile of all TAS2Rs in experimental cell lines

    • Consider using cell lines lacking endogenous bitter taste receptors

    • Quantify expression levels of all potentially cross-reactive TAS2Rs in experimental systems

When reporting TAS2R39 research findings, explicitly address potential cross-reactivity concerns and include appropriate controls demonstrating the specificity of the observed effects to TAS2R39 rather than other bitter taste receptors.

What are the most promising areas for future TAS2R39 research?

Based on current knowledge and gaps in the literature, several research directions for TAS2R39 appear particularly promising:

  • Structural biology approaches: Determining the crystal structure of TAS2R39 would significantly advance understanding of its ligand binding mechanisms and facilitate rational drug design of selective agonists and antagonists.

  • Physiological roles in non-gustatory tissues: Systematic investigation of TAS2R39 functions in:

    • Respiratory epithelium, particularly regarding inflammatory responses and potential antimicrobial effects

    • Gastrointestinal tract, focusing on hormone secretion and effects on appetite regulation

    • Nervous system, examining potential neuromodulatory effects

  • Therapeutic potential: Exploring TAS2R39 as a drug target for:

    • Respiratory conditions like asthma and allergic rhinitis

    • Metabolic disorders, given its potential role in regulating food intake

    • Anti-inflammatory applications, if its stimulation proves to modulate inflammatory pathways

  • Genetic association studies: Investigating correlations between TAS2R39 variants (though rare) and:

    • Susceptibility to respiratory infections

    • Inflammatory disease risk

    • Dietary preferences and metabolic health outcomes

  • Interaction with natural products: Further exploring how plant-derived compounds like theaflavins and catechins interact with TAS2R39 may provide insights into both the receptor's natural function and the mechanisms underlying these compounds' reported health benefits.

What technological advances would facilitate better characterization of TAS2R39?

Advancing TAS2R39 research would benefit significantly from several technological developments:

  • Improved structural determination methods: Adapting cryo-EM or crystallography techniques specifically for GPCRs with unconventional structures like TAS2Rs would enable direct visualization of ligand-binding interactions.

  • Enhanced receptor-specific tools:

    • Development of truly selective antibodies using novel approaches like camelid nanobodies

    • Creation of fluorescent or bioluminescent TAS2R39 sensors for real-time activation monitoring

    • Design of photoactivatable or genetically encoded TAS2R39-specific ligands

  • Advanced tissue models:

    • Organ-on-chip systems incorporating TAS2R39-expressing cells to model complex physiological responses

    • Patient-derived organoids to study TAS2R39 function in disease-relevant contexts

    • In vivo imaging techniques to visualize TAS2R39 activation in intact tissues

  • High-throughput screening platforms:

    • Customized compound libraries focused on TAS2R39 pharmacophore features

    • Multiplexed functional assays capable of simultaneously assessing multiple signaling outputs

    • AI-driven prediction models for identifying novel ligands based on structure-activity relationships

  • Single-cell analysis technologies:

    • Spatial transcriptomics to map TAS2R39 expression patterns with cellular resolution

    • Single-cell proteomics to identify cell-specific signaling partners

    • Patch-seq approaches combining electrophysiology with transcriptomics to correlate TAS2R39 expression with functional responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.