Recombinant Human Taste receptor type 2 member 3 (TAS2R3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Taste Receptor Type 2 Member 3 (TAS2R3)

Recombinant Human Taste Receptor Type 2 Member 3 (TAS2R3) is a genetically engineered form of the bitter taste receptor protein, part of the G protein-coupled receptor (GPCR) superfamily. It plays a critical role in detecting bitter compounds through taste receptor cells in the tongue and palate epithelia . Recombinant production enables large-scale synthesis for functional studies, drug discovery, and mechanistic investigations of bitter taste perception and extraoral physiological roles .

Primary Biological Functions

  • Bitter taste perception: Detects compounds like chloroquine

  • Signal transduction: Activates downstream pathways via Gα-gustducin, triggering calcium release

  • Extraoral roles: Modulates thyroid hormone levels and cancer risk (e.g., papillary thyroid carcinoma)

Key Pathways

TAS2R3 participates in multiple signaling cascades:

PathwayAssociated Proteins
Taste transductionTAS2R7, TAS2R16, PRKACA, SCNN1G
GPCR downstream signalingPDE10A, CHRM2, VIP2, OXGR1A.1
Class C/3 metabotropic receptorsCASR, TAS2R13, GPRC6A

Known Ligands

LigandBinding AffinityFunctional Impact
ChloroquineHigh specificityPrimary agonist in in vitro assays
Phenolic compoundsVariableInhibitory effects in Cornus mas fruit extracts

Genetic Variations and Clinical Relevance

  • rs2270009 (synonymous SNP): Linked to reduced papillary thyroid carcinoma risk (OR = 0.59) and lower TT3 levels

  • rs2234001: Forms protective CC haplotype with rs2270009

Table: High-Impact Genetic Variants

VariantTypeMAFPredicted Functional Impact
rs2708381Premature stop0.21Truncated receptor protein
rs1669412Nonsynonymous0.22Altered ligand-binding pocket

Recombinant Expression Systems

Host SystemYieldApplications
HEK293 cellsHighFunctional calcium imaging assays
E. coliModerateStructural studies, antibody production
Mammalian cell linesLowPost-translational modification studies

Research Applications

  • Bitter compound screening: Identified chloroquine as a reference agonist

  • Drug discovery: Evaluated flavonoids (e.g., quercetin) as TAS2R3 inhibitors

  • Cancer research: Explored TAS2R3-TAS2R4 haplotypes in thyroid cancer risk

Challenges and Future Directions

Current limitations include low-resolution structural data and incomplete ligand repertoire. Emerging priorities:

  1. Cryo-EM studies to resolve activation mechanisms

  2. High-throughput screening for novel modulators

  3. Population-scale analyses of TAS2R3 polymorphism-disease associations

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize its development.
Synonyms
TAS2R3; Taste receptor type 2 member 3; T2R3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MMGLTEGVFLILSGTQFTLGILVNCFIELVNGSSWFKTKRMSLSDFIITTLALLRIILLC IILTDSFLIEFSPNTHDSGIIMQIIDVSWTFTNHLSIWLATCLGVLYCLKIASFSHPTFL WLKWRVSRVMVWMLLGALLLSCGSTASLINEFKLYSVFRGIEATRNVTEHFRKKRSEYYL IHVLGTLWYLPPLIVSLASYSLLIFSLGRHTRQMLQNGTSSRDPTTEAHKRAIRIILSFF FLFLLYFLAFLIASFGNFLPKTKMAKMIGEVMTMFYPAGHSFILILGNSKLKQTFVVMLR CESGHLKPGSKGPIFS
Uniprot No.

Target Background

Function
Gustducin-coupled receptor involved in the perception of bitter compounds in the oral cavity and gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Gene References Into Functions
  1. Genetic polymorphisms in bitter taste receptor genes, specifically TAS2R3, -4, -5, and TAS2R38, contribute to variations in the bitterness perceived from chemicals. PMID: 26785164
  2. Our research indicates that the expression levels of certain T2R taste receptor genes are significantly increased in patients experiencing phantogeusia. PMID: 22397221
  3. A study investigated a polymorphic upstream ORF in this gene and demonstrated its role in reducing protein levels by approximately 58%. PMID: 19372376
Database Links

HGNC: 14910

OMIM: 604868

KEGG: hsa:50831

STRING: 9606.ENSP00000247879

UniGene: Hs.676011

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in the antrum and fundus (part of the stomach), duodenum and in gastric endocrine cells.

Q&A

What is TAS2R3 and what is its basic structure?

TAS2R3 is a member of the type 2 taste receptor family (TAS2Rs) that functions as a bitter taste receptor. It belongs to the G protein-coupled receptor (GPCR) superfamily and has the characteristic seven-transmembrane domain structure typical of GPCRs . The gene encoding TAS2R3 is located on chromosome 7q34 and is clustered with three other taste receptor genes. Unlike many other genes, TAS2R3 appears to be intronless, containing the complete coding sequence within a single exon .

The protein structure follows the canonical GPCR architecture with:

  • An extracellular N-terminal domain

  • Seven transmembrane helices

  • Intracellular loops that interact with G proteins

  • A C-terminal domain involved in signaling and regulation

How does TAS2R3 function as a bitter taste receptor?

TAS2R3 functions through canonical GPCR signaling mechanisms. Upon binding of bitter compounds to the receptor's binding pocket, TAS2R3 undergoes a conformational change that activates associated G proteins, primarily gustducin. This activation initiates downstream signaling cascades involving phospholipase C β2 (PLCβ2), which generates inositol 1,4,5-trisphosphate (IP3) and causes the release of calcium from intracellular stores. The calcium release ultimately leads to depolarization of taste cells and the transmission of bitter taste signals to the brain .

Unlike the sweet and umami taste receptors (T1R family) that function as heterodimers, TAS2R3 is believed to function as a monomer or homodimer, although research into potential interactions with other TAS2Rs is ongoing .

What are the common genetic polymorphisms in TAS2R3 and how do they affect receptor function?

Several single nucleotide polymorphisms (SNPs) have been identified in the TAS2R3 gene, with the most studied being rs765007 (C > T) located in the 5' UTR region . This polymorphism does not directly alter the protein sequence but may affect gene expression levels or mRNA stability.

Other significant polymorphisms include:

SNP IDNucleotide ChangeAmino Acid ChangeLocationFunctional Impact
rs765007C > TNone (5' UTR)5' UTRMay affect expression levels
rs2270009T > CNot specifiedCoding regionForms haplotype with TAS2R4 SNP rs2234001

The TAS2R3/4 haplotype analysis has revealed significant associations with physiological functions. Specifically, the CC haplotype (rs2270009 and rs2234001) has been associated with:

  • Lower risk for papillary thyroid carcinoma (PTC) compared to other haplotypes (odds ratio = 0.59, 95% confidence interval: 0.36–0.97)

  • Significantly reduced total triiodothyronine (TT3) levels (p = 0.005)

The diplotype analysis shows more detailed relationships:

TAS2R3/4 DiplotypeControls (%)PTC Cases (%)Odds Ratio (95% CI)P-value
TC/TC229 (44.6)121 (48.4)1.00 (Reference)-
TC/CG170 (33.1)84 (33.6)0.89 (0.64–1.27)0.549
CC/TC63 (12.3)14 (5.60)0.43 (0.23–0.79)0.007
CG/CG35 (6.82)21 (8.40)1.07 (0.59–1.94)0.822
CC/*49 (15.4)24 (9.60)0.59 (0.36–0.97)0.036

This data demonstrates that TAS2R3 genetic variations may significantly impact disease susceptibility beyond taste perception .

How do TAS2R3 polymorphisms compare to other TAS2R family members in terms of population genetics?

TAS2R3 shows moderate levels of genetic diversity compared to other TAS2R family members. In global population studies, nucleotide diversity (π) across the TAS2R family ranges from 0.005% in TAS2R39 to 0.358% in TAS2R20, with a mean of 0.12%. Most TAS2R genes, including TAS2R3, show π values between the 5th and 95th percentiles of the genome-wide empirical distribution, suggesting neutral evolution .

Population differentiation measured by FST for TAS2R3 is relatively low compared to some other family members like TAS2R8, 13, 16, 20, 42, and 50, which show FST values exceeding expectation (PE > 0.95). This suggests that TAS2R3 may have been under less selective pressure during human evolution than these other bitter receptors .

Unlike TAS2R38, which shows a clear relationship between genetic variants and phenotypic differences in perception of specific bitter compounds like isothiocyanates, the phenotypic consequences of TAS2R3 variations remain less well-characterized .

Where is TAS2R3 expressed beyond taste buds and what functions does it serve in these tissues?

TAS2R3 was initially identified in taste receptor cells of the tongue and palate epithelia, but research has revealed wider expression patterns with important extraoral functions :

  • Thyroid Gland: TAS2R3 is expressed in thyrocytes where it influences thyroid hormone production. Genetic variations in TAS2R3 affect total triiodothyronine (TT3) levels, suggesting a regulatory role in thyroid function .

  • Respiratory System: Like other TAS2Rs, TAS2R3 is expressed in bronchial epithelial cells where it may contribute to defensive responses against inhaled irritants and bacterial components. Activation of airway TAS2Rs can trigger protective responses such as increased ciliary beat frequency and bronchodilation .

  • Gastrointestinal Tract: TAS2R3 is found in enteroendocrine cells where it may mediate hormonal responses to detect toxins or regulate digestion. Stimulation of gut TAS2Rs can trigger endocrine responses and affect gastric emptying .

The extraoral functions of TAS2Rs, including TAS2R3, appear to be largely defensive in nature, helping to detect potentially harmful compounds and trigger appropriate physiological responses .

How does TAS2R3 contribute to thyroid function and what is its relationship with thyroid diseases?

TAS2R3 plays a significant role in thyroid function through direct effects on thyrocytes. The thyrocyte-expressed TAS2R3 controls thyroid hormone production, and genetic variations in this receptor directly impact thyroid hormone levels .

Key findings on the relationship between TAS2R3 and thyroid function include:

  • The TAS2R3/4 CC haplotype (rs2270009 and rs2234001) is associated with significantly reduced total triiodothyronine (TT3) levels (p = 0.005) .

  • Individuals with the TAS2R3/4 CC haplotype have a lower risk for papillary thyroid carcinoma (PTC) compared to those with other haplotypes (odds ratio = 0.59, 95% CI: 0.36–0.97) .

  • In the entire study population, TT3 levels for individuals with the CC/TC diplotype were lower than for individuals with other diplotypes (p = 0.05) .

This evidence suggests that TAS2R3's regulatory role in thyroid hormone production may directly influence susceptibility to thyroid diseases, potentially through altered hormone levels that affect cellular growth and differentiation pathways .

What techniques are used for genotyping TAS2R3 polymorphisms in research settings?

Researchers employ several molecular techniques to genotype TAS2R3 polymorphisms:

  • High-Resolution Melting (HRM) Analysis: This is a post-PCR analysis method used to identify variations in nucleic acid sequences. For TAS2R3 SNPs like rs765007, HRM reactions can be performed on genomic DNA with specifically designed primers. The reaction mixture typically contains primers (around 5 pmol each), a hot-start reaction mix (like LightCycler 480 high resolution melting master), and optimized Mg²⁺ concentrations (typically 2 mmol for rs765007) .

The HRM reaction profile typically follows:

  • Preincubation at 95°C for 1 min

  • 45 cycles at 95°C for 10 s, 64°C for 15 s, 72°C for 15 s

  • High-resolution melting in the range of 70–90°C (ramp rate of 0.02°C/s and 25 acquisitions per °C)

The amplified DNA fragment for rs765007 (TAS2R3) is typically 117 bp in length .

  • Next-Generation Sequencing: For comprehensive analysis of all variations within TAS2R3, next-generation sequencing can be employed. This allows for identification of both known and novel variants .

  • PCR-RFLP (Restriction Fragment Length Polymorphism): This technique can be used to detect specific known SNPs through restriction enzyme digestion of PCR products.

  • Variant Effect Predictor (VEP): For functional analysis of identified variants, computational tools like VEP can be used to categorize variants as synonymous, nonsynonymous, premature stop, etc. .

What expression systems are effective for studying recombinant TAS2R3 protein function?

Studying recombinant TAS2R3 function presents challenges similar to those of other GPCRs. While the search results don't specifically describe expression systems for TAS2R3, studies on related taste receptors provide applicable methodologies:

  • Mammalian Cell Expression Systems: HEK293 cells, particularly tetracycline-inducible HEK293S cell lines, have been successfully used for expression of taste receptors like TAS1R2. This system allows for controlled expression of the receptor and can be adapted for TAS2R3 studies .

  • Purification of Detergent-Solubilized Receptors: After expression, the receptor can be purified following detergent solubilization. Proper folding of the purified receptor can be confirmed using circular dichroism (CD) spectroscopy .

  • Functional Assays:

    • Calcium Imaging: Since TAS2R activation leads to calcium release, calcium-sensitive fluorescent dyes can be used to measure receptor activation in response to potential ligands.

    • Intrinsic Tryptophan Fluorescence: This technique can be used to assess ligand binding to the purified receptor, as demonstrated with TAS1R2 .

    • Bioluminescence Resonance Energy Transfer (BRET): For studying receptor-G protein interactions.

  • Heterologous Expression with G Protein Components: Co-expression of TAS2R3 with G protein components such as gustducin or chimeric G proteins can enhance signaling responses in heterologous systems.

When designing such expression systems, it's important to consider the addition of appropriate tags for purification and detection, while ensuring these modifications don't interfere with receptor function.

What is the evidence linking TAS2R3 variants to papillary thyroid carcinoma risk?

Research has established a significant association between TAS2R3 genetic variations and papillary thyroid carcinoma (PTC) risk:

  • A case-control study with 763 Korean females, including 250 PTC cases, demonstrated that individuals with the TAS2R3/4 CC haplotype (rs2270009 and rs2234001) had a significantly lower risk for PTC compared to those with other haplotypes (odds ratio = 0.59, 95% confidence interval: 0.36–0.97) .

  • Diplotype analysis showed an even stronger protective effect for the CC/TC diplotype, with an odds ratio of 0.43 (95% CI: 0.23–0.79, p = 0.007) .

  • The protective effect of the TAS2R3/4 CC haplotype against PTC was accompanied by significantly reduced total triiodothyronine (TT3) levels (p = 0.005), suggesting a potential mechanism through altered thyroid hormone production .

This evidence points to a biological pathway where:

  • TAS2R3 variants affect receptor function in thyrocytes

  • Altered receptor function modifies thyroid hormone production

  • Changed hormone levels influence thyroid cell growth and differentiation

  • These cellular changes ultimately impact susceptibility to papillary thyroid carcinoma

The specificity of this association to TAS2R3/4 is notable, as no other tested TAS2R genetic variants exhibited critical associations with PTC phenotype and biomarkers in the same study .

How does TAS2R3 function in immune response and inflammation?

While the search results don't provide specific details about TAS2R3's role in immune response and inflammation, studies on the broader TAS2R family suggest potential immunomodulatory functions:

  • TAS2Rs, including TAS2R3, are expressed in respiratory epithelial cells where they can detect bacterial quorum-sensing molecules and trigger defensive responses .

  • In the airways, TAS2Rs mediate responses to both endogenous and exogenous compounds entering the lungs, and likely participate in immune responses .

  • Activation of airway TAS2Rs can trigger protective responses such as increased ciliary beat frequency and bronchodilation, which help clear pathogens and irritants .

  • Some TAS2Rs have been linked to susceptibility to respiratory infections, with TAS2R38 variants being associated with susceptibility to infection . Similar mechanisms may apply to TAS2R3.

  • In the gut, TAS2Rs may detect compounds produced by intestinal flora, potentially playing a role in monitoring the gut microbiome and mediating responses to changing conditions in the intestinal environment .

The anti-pathogenic effects of TAS2R activation in the respiratory system have been noted, with certain variants affecting the severity of respiratory conditions like chronic rhinosinusitis .

How can computational modeling of TAS2R3 structure-function relationships advance our understanding of bitter taste perception?

Computational modeling of TAS2R3 represents an advanced approach to understanding its structure-function relationships:

  • Homology Modeling: Since crystal structures for TAS2Rs are not yet available, homology models based on related GPCRs can provide insights into the three-dimensional structure of TAS2R3. These models can predict the architecture of the ligand-binding pocket and suggest how genetic variants might alter receptor function.

  • Molecular Dynamics Simulations: These can reveal how TAS2R3 behaves in a lipid bilayer environment and how conformational changes occur upon ligand binding. Simulations can also predict how specific SNPs affect protein stability and dynamics.

  • Ligand Docking Studies: Virtual screening of compound libraries against TAS2R3 models can identify potential ligands and help understand the molecular basis of bitter compound recognition. These studies could also predict how genetic variations alter ligand binding properties.

  • Evolutionary Analysis: Computational analysis of TAS2R3 sequences across species can identify conserved regions critical for function and regions under selective pressure. The observed nucleotide diversity (π) and population differentiation (FST) metrics for TAS2R3 compared to other TAS2Rs suggest different evolutionary constraints that computational models could help explain .

  • Prediction of Functional Effects of Variants: Tools like PolyPhen-2 and SIFT have been used to predict which nonsynonymous SNPs in TAS2Rs alter receptor function. Of the 525 nonsynonymous substitutions observed across TAS2Rs, 182 SNPs were predicted to be Possibly or Probably Damaging by PolyPhen-2 and 188 had SIFT scores of Deleterious . Similar approaches focused specifically on TAS2R3 could identify functionally important variants.

What are the most promising approaches for studying the extraoral functions of TAS2R3 in disease models?

Advanced research into TAS2R3's extraoral functions requires sophisticated methodological approaches:

  • CRISPR/Cas9 Gene Editing: Creating precise TAS2R3 knockout or knock-in models (both cell lines and animal models) with specific polymorphisms can help establish causal relationships between receptor variants and disease phenotypes. This is particularly relevant for studying the role of TAS2R3 in thyroid cancer given the established associations .

  • Single-Cell Transcriptomics: This approach can identify cell-specific expression patterns of TAS2R3 in tissues like thyroid, airways, and gut, revealing potential functional heterogeneity that may be missed in bulk tissue analysis.

  • Organoid Models: Three-dimensional organoid cultures of thyroid tissue incorporating different TAS2R3 variants could provide insights into how these genetic differences affect thyroid hormone production and cancer susceptibility in a physiologically relevant context.

  • Patient-Derived Xenografts (PDX): For cancer studies, PDX models where patient tumors with characterized TAS2R3 genotypes are implanted in immunodeficient mice could help understand how receptor variants influence tumor progression and response to therapy.

  • Metabolomic Profiling: Since TAS2R3 appears to influence thyroid hormone levels , comprehensive metabolomic profiling in models with different TAS2R3 variants could reveal downstream metabolic pathways affected by receptor function.

  • Integration of Genetic and Environmental Factors: Studies that account for both TAS2R3 genetic variation and environmental exposures (such as dietary compounds that activate bitter taste receptors) could explain inter-individual differences in disease susceptibility.

  • Multi-omics Approaches: Integrating genomic, transcriptomic, proteomic, and metabolomic data from models with different TAS2R3 variants could provide a systems-level understanding of how this receptor influences cellular physiology and disease processes.

How do TAS2R3 interactions with other TAS2R family members affect signal transduction and cellular responses?

Understanding the potential interactions between TAS2R3 and other taste receptors represents a frontier in taste receptor biology:

  • Receptor Dimerization and Oligomerization: While T1R sweet and umami receptors function as heterodimers, the interaction patterns of TAS2Rs are less understood. Research could investigate whether TAS2R3 forms homodimers or heterodimers with other TAS2Rs, particularly with closely related TAS2R4, which forms a haplotype with TAS2R3 with functional consequences .

  • Shared Signaling Pathways: Multiple TAS2Rs may compete for or synergistically enhance common downstream signaling components like gustducin or PLCβ2. Advanced imaging techniques like FRET or BRET could reveal how TAS2R3 activation influences signaling by other TAS2Rs.

  • Cross-talk with Other Signaling Systems: Research could explore how TAS2R3 signaling interacts with pathways involved in thyroid hormone production or other physiological processes. This might explain how TAS2R3 variants affect TT3 levels .

  • Tissue-Specific Interactions: TAS2R3 may interact differently with other receptors depending on the cellular context, such as in taste buds versus thyrocytes. Cell-type specific interactome analysis could reveal these differences.

  • Ligand-Dependent Interaction Patterns: The nature of TAS2R3 interactions with other receptors might change depending on the activating ligand, potentially explaining diverse physiological effects of different bitter compounds.

This research direction would help explain the observed associations between TAS2R3/4 haplotypes and both PTC risk and thyroid hormone levels, potentially revealing new therapeutic targets for thyroid disorders and other conditions involving TAS2R3 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.