Recombinant Human Taste receptor type 2 member 41 (TAS2R41)

Shipped with Ice Packs
In Stock

Description

Introduction to TAS2R41

TAS2R41 is a bitter taste receptor encoded by the TAS2R41 gene, clustered with eight other taste receptor genes on chromosome 7 . This seven-transmembrane G-protein-coupled receptor (GPCR) is primarily expressed in taste receptor cells of the tongue and palate epithelia, as well as in subsets of gastrointestinal cells . The recombinant form of TAS2R41 is engineered for research purposes, enabling detailed studies of its structural, functional, and pharmacological properties.

Key Agonists and Ligand Interactions

TAS2R41 exhibits narrow ligand specificity, with chloramphenicol identified as its primary agonist . Additional ligands include sucralose, a non-nutritive sweetener that evokes bitter sensations at high concentrations .

LigandRoleGenetic Variants Affecting Response
ChloramphenicolPrimary agonist L127 variant reduces response by ~10x
SucraloseBitter agonist Limited data on variant interactions

Mechanism: Binding induces conformational changes that activate gustducin (a G-protein), triggering downstream signaling via IP3 and TRPM5 channels, leading to cellular depolarization .

Genetic Variants and Functional Implications

Polymorphisms in TAS2R41 influence bitter perception and drug responses:

  • L127 variant: Causes reduced sensitivity to chloramphenicol compared to the P127 variant .

  • Population diversity: Global studies reveal low-frequency variants (e.g., MAF < 0.004), suggesting evolutionary pressures on bitter taste perception .

VariantEffect on FunctionClinical Relevance
L127~10x reduced chloramphenicol responsePotential impact on medication compliance
P127Full functionalityReference allele for TAS2R41 studies

Applications in Research and Assay Development

Recombinant TAS2R41 is critical for studying bitter taste mechanisms and drug interactions:

  • Blocking experiments: A control fragment (aa 66–86) is used to validate antibody specificity (e.g., PA5-63394) in IHC/ICC/WB .

  • Ligand screening: Engineered TAS2R41 variants (e.g., N-terminal signal sequence modifications) enhance cell surface expression, improving assay sensitivity .

ApplicationMethodOutcome
Antibody validationPre-incubation with recombinant fragmentBlocks antibody binding in IHC/ICC/WB
Functional assaysBioluminescence-based calcium releaseQuantifies agonist-induced signaling
Genetic variant analysisHaplotype expression in HEK293 cellsIdentifies functional/nonfunctional alleles

Signaling Pathways and Downstream Effects

TAS2R41 activation triggers a canonical bitter taste pathway:

  1. Ligand binding → G-protein (gustducin) activation → IP3 production → TRPM5 channel opening → ATP release → neuronal signaling .

Key Interactions:

  • Gustducin: Couples TAS2R41 to downstream effectors .

  • TRPM5: Mediates depolarization and neurotransmitter secretion .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly include them in your order remarks. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will select the tag type during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
TAS2R41; Taste receptor type 2 member 41; T2R41; Taste receptor type 2 member 59; T2R59
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MQAALTAFFVLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRFCLQL VGTVHNFYYSAQKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHSTFL WLKWRFPGWVPWLLLGSVLISFIITLLFFWVNYPVYQEFLIRKFSGNMTYKWNTRIETYY FPSLKLVIWSIPFSVFLVSIMLLINSLRRHTQRMQHNGHSLQDPSTQAHTRALKSLISFL ILYALSFLSLIIDAAKFISMQNDFYWPWQIAVYLCISVHPFILIFSNLKLRSVFSQLLLL ARGFWVA
Uniprot No.

Target Background

Function
Taste receptor type 2 member 41 (TAS2R41) is a receptor that may play a role in the perception of bitterness and is linked to gustducin. It potentially contributes to sensing the chemical composition of gastrointestinal contents. The activation of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Database Links

HGNC: 18883

OMIM: 613965

KEGG: hsa:259287

STRING: 9606.ENSP00000386201

UniGene: Hs.650648

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.

Q&A

Basic Research Questions

  • What is TAS2R41 and what is its primary function in human biology?

    TAS2R41 is a member of the taste 2 receptor (TAS2R) family, which comprises 25 bitter taste receptors in humans. These receptors are G protein-coupled receptors (GPCRs) that mediate bitter taste perception. TAS2R41 specifically functions as a "specialist" receptor with high selectivity for certain bitter compounds. Unlike broadly tuned bitter receptors that recognize numerous compounds, TAS2R41 has a narrow receptive range, recognizing only a few specific agonists . Its primary function is the detection of specific bitter compounds, with current evidence suggesting chloramphenicol as its main known agonist .

  • How is TAS2R41 expression distributed throughout human tissues?

    While TAS2R41 was initially identified in taste buds, research has revealed the expression of bitter taste receptors including TAS2R41 in various extraoral tissues. Studies have detected TAS2R41 along the gastrointestinal tract, with varying expression levels in different segments. Research by Jalsˇevac et al. (2024) showed that TAS2R41 consistently exhibits lower expression levels compared to other TAS2Rs (such as TAS2R14) across various gastrointestinal mucosal tissues . This extraoral expression suggests potential roles beyond taste perception, possibly including metabolic regulation and gut-brain axis modulation.

  • What are the confirmed agonists for human TAS2R41?

    TAS2R41 has a remarkably narrow agonist profile compared to other bitter taste receptors. The antibiotic chloramphenicol has been identified as its primary agonist through heterologous expression systems and functional assays . Thalmann et al. (2013) were the first to identify this specific interaction. Additionally, there is evidence suggesting that the non-nutritive sweetener sucralose may also activate TAS2R41 at certain concentrations, making it one of the few receptors known to interact with both bitter and sweet-tasting compounds . The highly selective nature of TAS2R41 may indicate specialized roles in detecting specific compounds rather than broad bitter taste detection.

  • How does TAS2R41 compare structurally to other bitter taste receptors?

    TAS2R41, like other bitter taste receptors, belongs to the class T2 G protein-coupled receptor family. It contains seven transmembrane domains characteristic of GPCRs. TAS2R receptors, including TAS2R41, exhibit very minor homology with other GPCR families, making structural characterization challenging . Unlike sweet taste receptors (TAS1R family) that function as heterodimers, TAS2R41 functions as a monomeric receptor. The receptor lacks the large extracellular N-terminal domain seen in TAS1R family members . The structural specificity of TAS2R41 likely contributes to its narrow agonist selectivity, although detailed structural analyses through crystallography or cryo-EM have not yet been reported for this specific receptor.

Advanced Research Questions

  • What are the current methodologies for functionally characterizing TAS2R41?

    Several complementary methodologies have been developed to study TAS2R41 function:

    • Heterologous Expression Systems: TAS2R41 can be expressed in cell lines such as HEK293S cells using tetracycline-inducible systems for controlled expression .

    • Calcium Imaging Assays: Traditional approaches monitor changes in intracellular calcium levels upon receptor activation, though these can be limited by interference from autofluorescent compounds .

    • Bioluminescence-Based Assays: Recently developed methods offer improved signal windows and reduced interference from autofluorescent matrices. These assays utilize mt-clytin II (a calcium-dependent photoprotein) to monitor receptor activation with greater sensitivity than fluorescence-based methods .

    • BRET-Based Binding Assays: By fusing TAS2R41 to nanoluciferase (Nluc) either at the N- or C-terminus, researchers can develop BRET-based binding assays to directly measure ligand interactions .

    • Tryptophan Fluorescence: Intrinsic tryptophan fluorescence can be used to demonstrate binding of compounds to purified receptors and determine binding affinities .

  • How do genetic variations in TAS2R41 affect receptor function and bitter taste perception?

    Genetic variability in TAS2R41 significantly impacts receptor function:

    Genetic VariantFunctional ImpactReference
    P127L (rs10772420)~10-fold reduction in response to chloramphenicolThalmann et al. (2013)

    These genetic variations explain differential bitter perception of certain compounds among individuals. For example, the P127 variant of TAS2R41 shows significantly higher activation by chloramphenicol compared to the L127 variant . This functional polymorphism may have clinical relevance, as individuals with the more responsive P127 variant might perceive greater bitterness from chloramphenicol-containing medications, potentially affecting medication compliance. Studies have shown that variation in TAS2R genes can predict perceived bitterness of medications, suggesting potential applications in personalized medicine approaches .

  • What expression systems are most effective for producing functional recombinant TAS2R41?

    Several expression systems have been utilized for producing functional TAS2R41:

    • Mammalian Cell Lines: HEK293S cells with tetracycline-inducible systems provide controlled expression and appropriate post-translational modifications necessary for receptor function .

    • AD-293 or 293AD Cell Lines: These modified HEK293 cell lines offer stronger adherent properties, facilitating media changes during functional assays .

    • Cell-Free Protein Synthesis (CFPS): The ALiCE® system based on Nicotiana tabacum lysate has been reported for TAS2R41 expression, maintaining the protein production machinery while removing components unnecessary for expression .

    Challenges in expression include low expression levels, potential misfolding, and difficulties in purification. Strategies to improve expression include:

    • Altering N-terminal signal sequences to enhance cell surface expression

    • Co-expression with appropriate G proteins (typically Gα16-gust44)

    • Optimization of detergent conditions for solubilization while maintaining receptor function

  • How does human TAS2R41 differ from its mouse ortholog?

    Human TAS2R41 and its mouse ortholog (t2r41_mouse) show several important differences:

    • Sequence Variation: The mouse ortholog (also known as Tas2r41, Tas2r12, Tas2r126, or Tas2r26) has distinct sequence features compared to the human variant .

    • Agonist Profiles: Sequence-orthologous bitter taste receptors between human and mouse have distinct agonist profiles, suggesting divergent evolution of their ligand-binding properties .

    • Receptor Tuning: When compared with humans, mice possess fewer broadly tuned receptors and more narrowly tuned receptors like TAS2R41, supporting the idea that larger receptor repertoires enable the evolution of more specialized receptors .

    • Expression Patterns: Expression levels of mouse Tas2r41 and orthologous receptors have been studied using qRT-PCR and in situ hybridization, showing varying expression across taste cells .

    These differences highlight the importance of species-specific considerations when using mouse models to study bitter taste receptors and extrapolating findings to human taste perception.

  • What are the current methods for developing selective TAS2R41 agonists and antagonists?

    Developing selective compounds for TAS2R41 involves several approaches:

    1. Structure-Activity Relationship (SAR) Studies: Analyzing structural features of known agonists like chloramphenicol to identify essential molecular determinants for receptor activation .

    2. Fluorescent Derivatives: Synthesizing fluorescent derivatives of agonists by introducing fluorophores at specific positions (e.g., meta- or para-positions of aromatic rings) with appropriate linkers to maintain bioactivity while enabling binding detection .

    3. Click Chemistry Approaches: Utilizing azide- or alkyne-functionalized dyes (such as TAMRA-5 or TAMRA-6) connected via linkers of varying length and polarity to develop probes for binding studies .

    4. Computational Modeling: Despite challenges due to low homology with other GPCRs, homology modeling and molecular docking can guide rational design of selective ligands .

    5. High-Throughput Screening: Testing diverse compound libraries using bioluminescence-based assays that offer improved signal windows compared to traditional fluorescence-based methods .

  • How can CRISPR-Cas9 technology be applied to study TAS2R41 function?

    CRISPR-Cas9 technology offers powerful approaches for studying TAS2R41:

    • Gene Knockout Studies: gRNA sequences designed by the Feng Zhang laboratory specifically target TAS2R41 within the human genome with minimal off-target effects .

    • gRNA Design Considerations: When designing knockout experiments, researchers should consider:

      1. Using at least two gRNA constructs per gene to increase success rates

      2. Confirming gRNA sequences against target gene sequences before ordering

      3. Targeting specific exons or splice variants as needed

    • Delivery Methods: Typically, a sequence-verified plasmid containing all required elements (U6 promoter, spacer sequence, gRNA scaffold, and terminator) is delivered to cells .

    • Functional Validation: Following genetic modification, receptor function can be assessed using calcium mobilization assays, bioluminescence-based assays, or other functional readouts to confirm successful knockout or modification .

    • Phenotypic Analysis: In cellular or animal models, altered bitter taste responses to chloramphenicol can serve as functional validation of successful TAS2R41 modification .

  • What are the pharmacological implications of TAS2R41 activation in clinical settings?

    TAS2R41 activation has several potential pharmacological implications:

    • Medication Compliance: Genetic variants in TAS2R41 (particularly P127L) affect bitterness perception of chloramphenicol, potentially influencing patient compliance with antibiotic treatment regimens .

    • Personalized Medicine Approaches: Screening patients for TAS2R41 variants could inform personalized formulation strategies for medications with known bitter tastes .

    • Extraoral Effects: Given the expression of TAS2R41 in gastrointestinal tissues, activation may influence gut hormone secretion and metabolic processes beyond taste perception .

    • Dosage Form Considerations: The impact of TAS2R41 activation on perceived bitterness is particularly relevant for liquid oral formulations rather than tablets or capsules that bypass taste receptors .

    • Potential for Targeted Formulations: Understanding TAS2R41 genetics could enable development of personalized medication formulations based on patient genetic profiles to improve compliance and outcomes .

  • What are the current challenges in purifying functional TAS2R41 for structural studies?

    Purification of functional TAS2R41 presents several challenges:

    • Expression Levels: TAS2R41 typically expresses at low levels in heterologous systems, complicating large-scale purification efforts .

    • Detergent Solubilization: Appropriate detergent selection is critical for maintaining receptor structure and function during solubilization from cell membranes .

    • Structural Validation: Circular dichroism (CD) spectroscopy can confirm proper folding with evidence of secondary structures after purification .

    • Functional Assessment: Intrinsic tryptophan fluorescence assays can verify that purified receptors maintain ligand-binding capabilities with physiologically relevant affinities .

    • Stability Issues: Like many GPCRs, TAS2R41 may exhibit limited stability in detergent solutions, requiring optimization of buffer conditions and potentially the use of stabilizing agents or nanodiscs for structural studies .

    Despite these challenges, successful purification of detergent-solubilized TAS2R41 has been reported, with evidence of proper folding and maintained binding ability for compounds like sucralose, neotame, acesulfame-K, and perillartine .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.