Recombinant Human Taste receptor type 2 member 43 (TAS2R43)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant TAS2R43 is synthesized using advanced platforms such as Magic™ Membrane Protein Production (Creative Biolabs) :

  • Expression Systems: Mammalian (e.g., HEK-293) and insect cell lines for proper post-translational modifications .

  • Purification: Affinity chromatography with tags (e.g., GST) and stabilization using lipid nanodiscs .

  • Validation: Functional assays (calcium imaging) confirm receptor activity .

Challenges:

  • Low yield due to hydrophobic transmembrane regions .

  • Requires detergent optimization to maintain structural integrity .

Ligand Specificity and Signaling

Recombinant TAS2R43 responds to diverse agonists and antagonists:

CompoundEffectStudy Model
CaffeineAgonist; triggers Ca²⁺ signaling .HEK-293T, HGT-1 cells
Aristolochic AcidAgonist; linked to nephrotoxicity .In vitro assays
(R)-CitronellalAntagonist; blocks caffeine response .Cell-based assays
HED (Hesperetin)Antagonist; reduces gastric acid secretion .Human intervention

Genetic Polymorphisms

  • W35S/H212R Variants: Reduce receptor activity by >90%, correlating with lower caffeine bitterness perception and altered coffee preference .

  • Population Diversity: Over 166 predicted functional variants exist, though most are rare (frequency <0.01) .

Extraoral Functions

  • Gut Physiology: Mediates caffeine-induced gastric acid secretion via parietal cells .

  • Immune Modulation: Potential role in detecting bacterial quorum-sensing molecules .

Drug Development

  • Bitter Masking Agents: HED and structural analogs inhibit TAS2R43 to mitigate drug aftertastes .

  • Toxicity Screening: Detects aristolochic acid exposure, a carcinogenic contaminant .

Food Science

  • Guides formulation of low-bitterness nutraceuticals and artificial sweeteners .

Disease Research

  • Links TAS2R43 dysfunction to metabolic disorders (e.g., glucose dysregulation) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please specify them during order placement.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TAS2R43; Taste receptor type 2 member 43; T2R43; Taste receptor type 2 member 52; T2R52
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW VLLLNWYSTVLNPAFNSVEVRTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLH LKRRVKSVILVMLLGPLLFLACHLFVINMNEIVRTKEFEGNMTWKIKLKSAMYFSNMTVT MVANLVPFTLTLLSFMLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAI YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVFWQMRYW VKGEKTSSP
Uniprot No.

Target Background

Function

Gustducin-coupled receptor involved in the detection of bitter compounds within the oral cavity and gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5. Activated by the artificial sweeteners saccharin and acesulfame K. In airway epithelial cells, bitter compound binding increases intracellular calcium ion concentration and stimulates ciliary beat frequency. It may function as a chemosensory receptor in airway epithelial cells, facilitating the detection and removal of potentially harmful agents from the airways.

Gene References Into Functions
  1. Individuals with at least one sensitive TAS2R38 allele (AP or PP genotype) exhibited a higher likelihood of rejecting liquid medications compared to those with the non-taster allele (AA genotype). PMID: 26391354
  2. This study highlights the distinct response profiles of feline bitter receptors Tas2r38 and Tas2r43 compared to their human orthologs. PMID: 26037485
  3. The influence of the TAS2R43 gene on coffee preference is mediated by caffeine, particularly the H212R variant. PMID: 24647340
  4. Research indicates that bitter compounds elicit specific physiological effects in cells expressing type 2 taste receptors (T2Rs). PMID: 22964302
  5. The TAS2R43 mutational polymorphism significantly impacts susceptibility to BEN, suggesting a potentially broad role for toxin responses in individual health risks. PMID: 23050764
  6. Our findings demonstrate a significant increase in the expression rate of several T2R taste receptor genes in patients with phantogeusia. PMID: 22397221
  7. hTAS2R43 and hTAS2R44 function as cognate bitter taste receptors and do not contribute to the sweet taste of saccharin and acesulfame K. PMID: 15537898
  8. The hT2R43 gene allele enhances sensitivity to the bitterness of saccharin; similarly, an allele of a closely related gene (hT2R44) also increases saccharin bitterness sensitivity. PMID: 17702579
Database Links

HGNC: 18875

OMIM: 612668

KEGG: hsa:259289

STRING: 9606.ENSP00000431719

UniGene: Hs.688195

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium membrane. Note=In airway epithelial cells, localizes to motile cilia.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells. Expressed in airway epithelia.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.