Recombinant Human Taste receptor type 2 member 46 (TAS2R46)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Human TAS2R46 is a 309-amino acid G protein-coupled receptor (GPCR) produced through E. coli expression systems with an N-terminal His tag for purification . It features:

  • 7 transmembrane domains (TMs) connected by three extracellular (ECL) and intracellular loops (ICL)

  • A ligand-binding pocket in the extracellular region involving TMs II, III, V, VI, and VII

  • Secondary structure composition: 70-75% α-helices, 20% coils/turns, and <2% β-sheets

Table 2: Non-Taste Physiological Roles

Tissue/Cell TypeFunctionCitation
Airway smooth muscleRegulates bronchodilation via calcium oscillation modulation
Skeletal muscle cellsMediates cholinergic-induced relaxation through absinthin binding
Monocytes/MacrophagesReduces oxidative burst via SOD1/GPX1 pathway regulation
Bone marrow stromaModulates mesenchymal stem cell differentiation

Ligand Pharmacology

Table 3: Key Ligands and Effects

LigandEC₅₀/IC₅₀Biological EffectClinical Relevance
Strychnine10 μMFull agonist; induces TM3-TM6 conformational shift Neurotoxic alkaloid
Absinthin30 μMAnti-inflammatory response in skeletal muscle Potential myoprotective agent
Atropine100 μMPartial agonist; alters calcium dynamics Anticholinergic drug

Clinical and Therapeutic Implications

  • Inflammatory Bowel Disease: SNP rs2708380 (L228M) correlates with disease susceptibility

  • Oxidative Stress: TAS2R46 activation reduces PMA-induced ROS by 64% in monocytes

  • Drug Development: 68 identified ligands enable structure-activity relationship studies

Technical Applications

  • Calcium Imaging: Used to quantify receptor activation via Fluo-4 AM assays

  • Network Analysis: Eigenvector centrality mapping identifies signal transduction hubs

  • Mutagenesis Platforms: 31 documented point mutants for functional studies

Challenges and Future Directions

  • Expression Limitations: Low yields (0.1-1.0 mg/mL) in prokaryotic systems

  • Structural Dynamics: Lack of class A GPCR activation markers (e.g., TM6 outward movement)

  • Therapeutic Targeting: Requires subtype-specific agonists to avoid off-target effects

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your requirement when placing the order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R46; Taste receptor type 2 member 46; T2R46; Taste receptor type 2 member 54; T2R54
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MITFLPIIFSILIVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW VLVLNWYATELNPAFNSIEVRITAYNVWAVINHFSNWLATSLSIFYLLKIANFSNLIFLH LKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVT ILANLVPFTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSMKVHIKALQTVTSFLLLCAI YFLSIIMSVWSFESLENKPVFMFCEAIAFSYPSTHPFILIWGNKKLKQTFLSVLWHVRYW VKGEKPSSS
Uniprot No.

Target Background

Function
TAS2R46, a receptor, potentially plays a role in the perception of bitterness and is linked to gustducin. It may contribute to sensing the chemical composition of gastrointestinal content. Activation of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to TRPM5 gating. In airway epithelial cells, binding of bitter compounds increases intracellular calcium ion concentration and stimulates ciliary beat frequency.
Gene References Into Functions
  1. Gastrointestinal cancer risk is not associated with any TAS2R46 genotypes, as there were no significant differences in genotype frequencies between cancer patients and controls. PMID: 28552880
  2. Mesenchymal stem cells express the bitter taste receptor, TAS2R46, a protein typically localized to the taste bud. Expression was also confirmed in vascular smooth muscle cells. PMID: 23520545
Database Links

HGNC: 18877

OMIM: 612774

KEGG: hsa:259292

STRING: 9606.ENSP00000436450

UniGene: Hs.688193

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium membrane. Note=In airway epithelial cells, localizes to motile cilia.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells. Expressed on ciliated airway epithelium.

Q&A

What is TAS2R46 and how is it classified within GPCRs?

TAS2R46 is a bitter taste receptor belonging to the taste receptor type 2 (TAS2R) family. Recent classifications have placed TAS2Rs into class T of G protein-coupled receptors (GPCRs), which is characterized by distinct features that differentiate them from class A receptors . This classification recognizes the unique structural characteristics of TAS2Rs that influence their function and ligand interactions . Understanding this classification is critical for researchers studying the receptor's biomechanics and signaling pathways.

What are the known ligands for TAS2R46?

TAS2R46 responds to various bitter compounds, with strychnine being one of the well-studied agonists used in structural and functional analyses . In experimental settings, absinthin has also been used to study TAS2R46 functionality in skeletal muscle cells . When designing experiments, researchers should consider that different ligands may induce distinct conformational changes and downstream effects, which can be critical for exploring receptor mechanisms in various tissue contexts.

How does TAS2R46 differ from other bitter taste receptors?

Among the 25 human bitter taste receptor subtypes, TAS2R46 appears to be prominently expressed in skeletal muscle compared to other TAS2R isoforms . The unique structural features of TAS2R46 contribute to its specific ligand binding profile and functional properties. Molecular dynamics studies indicate that TAS2R46 may possess activation mechanisms that are not fully understood and differ from those of other GPCR families . These unique characteristics make it important to study TAS2R46 as a distinct entity rather than generalizing findings from other bitter taste receptors.

In which tissues is TAS2R46 expressed beyond the oral cavity?

Recent research has experimentally demonstrated the presence of TAS2R46 in human skeletal muscle cells from both the locomotor system and oral cavity . Immunohistochemistry analysis has confirmed that TAS2R46 protein is well expressed along the striated skeletal muscle fibers in both regions . This extra-oral expression suggests broader physiological roles beyond taste perception, potentially involving muscle function regulation. Researchers should consider examining other tissue types for TAS2R46 expression to fully map its distribution throughout the body.

How does TAS2R46 expression change during cellular differentiation?

TAS2R46 appears to be developmentally controlled, with higher expression levels observed in mature skeletal muscle cells compared to undifferentiated cells . This pattern mirrors what has been observed with TAS1R receptors, where expression increases during differentiation from myoblast to myocyte . For researchers studying developmental biology or muscle cell differentiation, this differential expression pattern provides an important consideration for experimental timing and cell model selection.

What techniques are most effective for detecting TAS2R46 expression in tissue samples?

Based on published research, a combination of qPCR analysis and immunohistochemistry has proven effective for detecting TAS2R46 expression. qPCR can quantify mRNA levels across multiple TAS2R subtypes simultaneously, while immunohistochemistry confirms protein expression and localization within tissue structures . When performing immunohistochemistry, appropriate controls are crucial, including secondary antibody-only staining to demonstrate the specificity of the primary antibody . For optimal detection sensitivity, researchers should consider using these complementary techniques rather than relying on a single method.

What conformational states have been identified for TAS2R46?

Three main conformational states of TAS2R46 have been characterized through molecular dynamics simulations:

These distinct states are characterized by different volumes of the orthosteric binding pocket, with the volume being higher in the absence of strychnine . Researchers studying receptor dynamics should consider these multiple states in their experimental design and interpretation.

What key residues are involved in TAS2R46 ligand binding and activation?

Several key residues play critical roles in TAS2R46 function:

ResiduePositionFunctional Significance
Y2416.48Shows distinct conformational changes between receptor states; critical for activation mechanism
N923.36Forms hydrogen bonds with Y241 in specific conformational states
T2747.48Interacts with Y241, contributing to receptor state transitions

The dihedral angle of Y241 (defined by atoms CA-CB-CG-CD1) shows distinct probability distributions across different receptor states, making it a key indicator of conformational changes . These specific residues should be focal points for site-directed mutagenesis studies examining receptor activation mechanisms.

How do molecular dynamics simulations contribute to understanding TAS2R46 function?

Molecular dynamics simulations coupled with network-based analysis techniques have provided valuable insights into TAS2R46 dynamics by:

  • Characterizing conformational changes in different receptor states

  • Identifying allosteric communication pathways from extracellular to intracellular regions

  • Evaluating interactions between strychnine and specific receptor residues

  • Measuring the volume changes in the orthosteric binding pocket upon ligand binding

  • Quantifying correlation patterns across different regions of the receptor

These computational approaches have revealed that ligand binding to TAS2R46 increases intra-receptor correlations, especially in regions important for G-protein binding . Researchers can leverage these simulation approaches to generate hypotheses that can be tested experimentally, particularly regarding allosteric mechanisms.

How does TAS2R46 activation affect calcium signaling in skeletal muscle cells?

TAS2R46 activation in skeletal muscle cells modulates calcium handling through a distinctive mechanism. Upon activation, TAS2R46:

  • Controls ER/mitochondrial synapses at the mitochondrial calcium uniporter (MCU)

  • Works via a cAMP/EPAC pathway

  • Reduces cytosolic calcium levels

  • Increases mitochondrial calcium buffering

  • Subsequently decreases muscle contraction

Importantly, TAS2R46 activation does not exhibit a direct effect alone but requires the presence of Ca²⁺-mobilizing transmitters to manifest its calcium-modulating effects . This mechanism suggests TAS2R46 has evolved to play a role in preventing excessive muscle contraction or mediating fatigue responses.

What is the relationship between TAS2R46 and mitochondrial function in skeletal muscle?

TAS2R46 activation influences mitochondrial calcium handling, which is significant for muscle function. The increased mitochondrial calcium buffering observed following TAS2R46 activation likely affects mitochondrial bioenergetics, although this aspect has not been directly investigated . Recent evidence showing that mutations in proteins involved in mitochondrial calcium transport lead to muscle dysfunction underscores the relevance of this mechanism . Researchers interested in the intersection of taste receptors and metabolic function should consider exploring how TAS2R46 activation might influence mitochondrial energy production and muscle performance.

How might TAS2R46 interact with other taste receptors in non-gustatory tissues?

There is speculation about potential synergy between TAS1R and TAS2R families in skeletal muscle, similar to what has been hypothesized in cancer cells . TAS1R may sensitize muscle toward nutrients, while TAS2R may maintain calcium homeostasis, preventing cellular overwork . This potential interplay suggests a coordinated system where different taste receptor families work together to regulate cellular function beyond taste perception. Future research should investigate this potential cross-talk between receptor families and its physiological significance.

What are the most effective methods for studying TAS2R46 signaling in vitro?

Based on published research, effective methods for studying TAS2R46 signaling include:

  • Calcium imaging assays: To monitor changes in cytosolic and mitochondrial calcium levels following receptor activation

  • cAMP measurement: To evaluate the involvement of cAMP/EPAC pathway

  • Contractility assessment: To measure functional outcomes of receptor activation in muscle preparations

  • Protein-protein interaction studies: To investigate interactions with downstream effectors

When designing these experiments, researchers should account for the observation that TAS2R46 effects are most evident in the presence of Ca²⁺-mobilizing transmitters rather than with receptor activation alone .

What computational approaches are most valuable for analyzing TAS2R46 structure and function?

Several computational techniques have proven valuable for TAS2R46 research:

  • Molecular dynamics simulations: To investigate conformational changes and binding pocket dynamics

  • Dynamical Network Analysis: Based on generalized correlation coefficients to examine structural communication within the receptor

  • Protein-Ligand Interaction Profiler (PLIP): To evaluate specific interactions between ligands and receptor residues

  • Binding pocket volume analysis: Using tools like Epock to assess changes in the orthosteric binding site

  • Correlation analysis: To identify patterns of intra-receptor communication

When applying these methods, researchers should consider that TAS2R46 may possess unique structural characteristics that differentiate it from other GPCR families, requiring specialized approaches for analysis .

What statistical approaches are recommended for analyzing TAS2R46 experimental data?

For TAS2R46 research, appropriate statistical methods include:

  • One-way ANOVA for comparing multiple experimental conditions

  • Dunn's test for adjusting for multiple testing when comparing control groups to treatment groups

  • Data presentation as mean ± SEM of independent experiments performed in triplicate

  • Significance threshold set at p < 0.05

What are the potential therapeutic implications of targeting TAS2R46 in skeletal muscle disorders?

Given TAS2R46's role in modulating calcium signaling and muscle contraction, it presents a potential target for disorders characterized by muscle fatigue or abnormal contraction, including muscular dystrophies . The rapid physiological effect of TAS2R46 agonists like absinthin on calcium modulation suggests a protective response mechanism that could be therapeutically harnessed . Future research should investigate whether TAS2R46 antagonists could decrease muscle fatigue in relevant disorders, while also exploring which endogenous compounds might naturally activate these receptors in physiological conditions.

How does the unique classification of TAS2Rs as class T GPCRs impact research approaches?

The classification of TAS2Rs into class T of GPCRs acknowledges their distinct structural and functional characteristics compared to other GPCR families . This classification has significant implications for research approaches:

  • Traditional GPCR activation markers may not apply directly to TAS2Rs

  • Unique structural characteristics may require specialized molecular probes and tools

  • Drug design strategies may need to be tailored specifically for this receptor class

  • Interpretation of allosteric mechanisms should consider class-specific patterns

Researchers should remain aware that activation mechanisms observed in class A GPCRs may not translate directly to TAS2R46, necessitating careful validation of experimental paradigms specific to this receptor class.

What factors explain the differential expression of TAS2R46 across tissues and what are the implications?

While TAS2R46 is expressed in both gustatory and non-gustatory tissues, the regulation mechanisms and functional significance of this differential expression remain unclear . Future research directions should explore:

  • Transcriptional and epigenetic regulation of TAS2R46 in different tissues

  • Whether TAS2R46 variants exist with tissue-specific functions

  • How developmental and environmental factors influence expression patterns

  • The evolutionary significance of taste receptor expression in non-gustatory tissues

Understanding these factors could provide insights into novel physiological roles for taste receptors beyond their canonical functions and potentially reveal new therapeutic targets for various conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.