Recombinant Human Taste receptor type 2 member 7 (TAS2R7)

Shipped with Ice Packs
In Stock

Description

Production of Recombinant TAS2R7

Recombinant TAS2R7 is typically produced using platforms like the Magic™ Membrane Protein Production System, which employs mammalian cells (e.g., HEK293) or E. coli for expression . Common strategies include:

  • Vector Design: Cloning the TAS2R7 gene with N-terminal signal peptides (e.g., rat somatostatin receptor 3) and C-terminal tags (e.g., HSV epitope) for trafficking and detection .

  • Expression Optimization: Codon optimization and transient transfection to enhance yield .

  • Mutagenesis: Site-directed mutagenesis to study residues critical for ligand binding (e.g., TM III, VI, VII) .

Expression Systems

SystemAdvantagesChallenges
HEK293 CellsProper post-translational modificationsLow yield for membrane proteins
E. coliHigh scalabilityLack of mammalian PTMs

Ligand Specificity

TAS2R7 is activated by diverse ligands:

  • Bitter Compounds: Diphenidol, chlorphenamine, cromolyn (at high concentrations) .

  • Metal Ions: Zn²⁺, Ca²⁺, Mg²⁺, Al³⁺ (EC₅₀ values in millimolar range) .

  • Specialized Agonists: Anthocyanin malvidin-3-glucoside (unique to TAS2R7) .

Signaling Mechanism

Activation triggers a gustducin-mediated pathway:

  1. Ligand binding induces conformational changes in TMs I, III, and VII .

  2. Gα-gustducin activation stimulates PLC-β2, increasing intracellular Ca²⁺ .

  3. TRPM5 channel opening depolarizes the cell, releasing ATP via CALHM1 .

Key Residues for Function

ResidueRoleEffect of Mutation
S7.50Stabilizes inactive stateHyperactivation if mutated to alanine
I1.53TM I-II-VII H-bond networkAlters ligand sensitivity
H8Post-TM VII motifCritical for metal ion response

Bitter Taste Perception Studies

  • Genetic Variants: SNPs like rs619381 modulate receptor activity and taste transduction efficiency .

  • Species Comparison: Chickens show Tas2r7 haplotypes linked to broad bitter compound recognition .

Extraoral Roles

  • Gastrointestinal Sensing: Mediates hormone release (e.g., ghrelin) in response to dietary bitter compounds .

  • Vascular Expression: Found in smooth muscle/endothelial cells of arteries, suggesting roles in vasoregulation .

Therapeutic Targets

  • Drug Interactions: TAS2R7 interacts with antibiotics, anti-inflammatory agents, and phytochemicals .

  • Disease Associations: Linked to metabolic disorders via gut-brain signaling pathways .

Challenges and Future Directions

  • Structural Biology: Lack of resolved 3D structure impedes rational drug design .

  • Ligand Promiscuity: Broad ligand profile complicates agonist/antagonist specificity .

  • Expression Limitations: Low yields in recombinant systems hinder biophysical studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your requirement when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know. We will prioritize developing the specified tag.
Synonyms
TAS2R7; Taste receptor type 2 member 7; T2R7; Taste receptor family B member 4; TRB4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLC VILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFKIGNFFHPLFL WMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHA STKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISF LLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVI WKVMSILKGRKFQQHKQI
Uniprot No.

Target Background

Function
Gustducin-coupled receptor involved in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Gene References Into Functions
  1. Similar to most Class A GPCRs, extracellular loop 2 in T2R7 plays a crucial role in agonist binding and activation. PMID: 29355483
Database Links

HGNC: 14913

OMIM: 604793

KEGG: hsa:50837

STRING: 9606.ENSP00000240687

UniGene: Hs.533754

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.

Q&A

What is TAS2R7 and how does it function in the bitter taste receptor family?

TAS2R7 is one of approximately 25 human bitter taste receptors (TAS2Rs) that collectively mediate the perception of bitter compounds. It belongs to the G protein-coupled receptor (GPCR) superfamily and functions by activating intracellular signaling cascades upon binding to specific ligands. Recent research has identified TAS2R7 as particularly responsive to divalent and trivalent metal salts, suggesting it may play a specialized role in detecting these compounds .

Unlike some broadly-tuned "generalist" bitter receptors in humans, TAS2R7 appears to have a more specific activation profile primarily centered around metal ions, though it may respond to other compounds as well. When activated, TAS2R7 couples to G proteins, leading to calcium mobilization that can be measured in functional assays .

How does TAS2R7 differ from other bitter taste receptors in terms of ligand specificity?

TAS2R7 demonstrates a distinctive activation profile compared to other human bitter taste receptors. While some TAS2Rs respond to a wide range of structurally diverse bitter compounds, TAS2R7 shows specific sensitivity to divalent and trivalent metal salts including zinc, calcium, magnesium, copper, manganese, and aluminum . Importantly, TAS2R7 does not respond to potassium chloride (a monovalent salt), indicating selectivity for higher-valence metal ions .

This metal-specific activation pattern distinguishes TAS2R7 from other bitter receptors that may respond primarily to plant compounds, synthetic bitter substances, or other chemical classes. The human bitter receptor family includes broadly-tuned "generalist" receptors, moderately tuned receptors, and narrowly tuned "specialist" receptors, with TAS2R7 falling into a specialized category for metal ion detection .

What are the most effective expression systems for producing functional recombinant human TAS2R7?

For functional expression of recombinant human TAS2R7, heterologous mammalian cell systems have proven most effective. The widely used approach involves:

  • Subcloning the TAS2R7 coding sequence into expression vectors such as pcDNA3.1(+)

  • Adding a signal peptide to the N-terminus (commonly the first 45 amino acids of rat somatostatin receptor 3) to improve membrane trafficking

  • Including an epitope tag (such as HSV glycoprotein D) at the C-terminus for detection purposes

  • Transiently transfecting HEK293T cells that stably express appropriate G proteins

This expression system allows for proper membrane localization and functional coupling to signaling machinery. For optimal TAS2R7 functional assays, cells expressing the chimeric G protein Gα16gust44 have shown superior sensitivity compared to those expressing only Gα15, especially for detecting agonists with lower efficacy .

What modifications to the TAS2R7 sequence are recommended to improve expression and detection?

Several modifications to the native TAS2R7 sequence are recommended to enhance expression, trafficking, and detection:

  • N-terminal signal peptide: Adding the first 45 amino acid residues of the rat somatostatin receptor 3 significantly improves cell surface expression .

  • C-terminal epitope tag: Adding the herpes simplex virus glycoprotein D (HSV) epitope facilitates detection via immunocytochemistry and western blotting .

  • Codon optimization: Although not explicitly mentioned in the search results, codon optimization for the expression host (typically mammalian cells) can improve protein yield.

  • Removal of retention signals: Modifying or masking any endoplasmic reticulum retention signals may improve cell surface trafficking.

When assessing membrane localization, immunocytochemistry should be performed on both permeabilized and non-permeabilized cells to distinguish between intracellular retention and successful surface expression .

What methods are most effective for characterizing TAS2R7 activation by metal ions?

The most effective methodology for characterizing TAS2R7 activation by metal ions involves calcium mobilization assays in heterologous expression systems:

  • Cell-based functional assay: HEK293T cells transiently transfected with TAS2R7 and stably expressing Gα16gust44 are loaded with calcium-sensitive fluorescent dyes (e.g., Fluo-4) .

  • Real-time calcium imaging: Upon receptor activation by metal ions, calcium release is measured as changes in fluorescence intensity (ΔF/F) .

  • Dose-response analysis: Testing various concentrations of metal salts allows for determination of threshold concentrations, EC50 values, and maximum response amplitudes.

  • pH controls: Since many metal salt solutions can be acidic, control experiments using equivalent pH solutions without metal ions are essential to confirm that responses are specifically due to metal activation rather than pH effects .

  • Molecular specificity controls: Testing monovalent salts (e.g., KCl) that do not activate TAS2R7 provides important negative controls .

This methodology allows researchers to quantitatively characterize the activation profile of TAS2R7 by different metal ions and compare relative potencies and efficacies.

Which metal ions activate TAS2R7 and what are their relative potencies?

TAS2R7 responds to a range of divalent and trivalent metal ions with varying degrees of efficacy. Based on the available data, the following metal ions have been confirmed to activate human TAS2R7:

Metal IonSalt FormConcentration TestedRelative Response
ZincZnSO₄20 mMStrong
CopperCuSO₄20 mMStrong
MagnesiumMgCl₂20 mMStrong
ManganeseMnCl₂20 mMVariable
AluminumAl₂(SO₄)₃20 mMVariable
CalciumCaCl₂20 mMVariable
PotassiumKClNot specifiedNo response

The receptor shows robust responses to zinc, copper, and magnesium salts, while responses to manganese, aluminum, and calcium show more variable efficacy . Importantly, TAS2R7 does not respond to the monovalent potassium salt, indicating specificity for divalent and trivalent metal cations . This selective activation pattern suggests TAS2R7 may serve as a specific detector for higher-valence metal ions in the bitter taste perception system.

What structural features of TAS2R7 are critical for metal ion binding?

Molecular modeling and mutagenesis studies have identified key structural elements of TAS2R7 that are critical for metal ion binding:

  • Histidine 94 (H94): This residue has been identified as essential for interaction with metal ions. Histidine residues commonly coordinate metal ions in proteins through their imidazole ring .

  • Glutamate 264 (E264): This acidic residue also plays a crucial role in metal coordination, likely through its negatively charged carboxyl group .

These two residues appear to form a binding pocket that can coordinate divalent and trivalent metal cations. The specificity for higher-valence cations over monovalent cations (like potassium) is likely due to the coordination geometry and charge density requirements for stable binding .

Site-directed mutagenesis of these residues significantly impacts receptor function, confirming their essential role in metal sensing by TAS2R7. This structural information provides valuable insights for researchers seeking to modify TAS2R7 specificity or develop antagonists.

How can I distinguish between direct activation of TAS2R7 by metal ions versus indirect effects?

Distinguishing direct receptor activation from indirect effects is crucial for accurate characterization of TAS2R7. Consider these methodological approaches:

  • pH controls: Many metal salts create acidic solutions. Test equivalent pH solutions without metal ions to rule out pH-induced effects. Research has shown TAS2R7 does not respond to citric acid at pH ~3, confirming pH alone does not activate the receptor .

  • Chelation experiments: Use metal chelators (EDTA, EGTA) to sequester free metal ions and observe if receptor activation is abolished.

  • Mutagenesis validation: Mutate key metal-binding residues (H94, E264) and confirm loss of response to metal ions while maintaining general receptor functionality .

  • Receptor specificity: Confirm that other bitter receptors do not respond to the same metal ions, or respond with different profiles, supporting TAS2R7's specific role .

  • Metal specificity: Demonstrate selectivity by showing TAS2R7 responds to divalent/trivalent ions but not monovalent ions under identical conditions .

Combined, these approaches provide strong evidence for direct activation rather than non-specific or indirect effects.

What are common challenges in achieving functional expression of TAS2R7 and how can they be addressed?

Researchers working with recombinant TAS2R7 commonly encounter these challenges:

  • Poor cell surface expression: Some bitter taste receptors show predominantly intracellular localization rather than membrane expression. Solution: Verify surface expression using immunocytochemistry on non-permeabilized cells. Add trafficking-enhancing elements like the rat somatostatin receptor 3 signal peptide to improve membrane localization .

  • Variable transfection efficiency: Inconsistent expression levels can complicate functional assays. Solution: Use epitope tags to confirm expression levels, optimize transfection protocols, and consider stable cell line development.

  • G-protein coupling inefficiency: Poor coupling to signaling machinery leads to weak responses. Solution: Use Gα16gust44 chimeric G proteins which show higher sensitivity than Gα15 for detecting TAS2R activation, especially for compounds with lower efficacy .

  • Receptor polymorphisms: Natural variants may affect functionality. Solution: Sequence verify your TAS2R7 construct against reference sequences (NCBI Reference Sequence: NP_076408.1) and consider testing known functional variants .

  • Non-physiological conditions: Cell culture conditions may not reflect taste cell environment. Solution: Optimize assay buffer conditions to match physiological parameters when possible.

By addressing these challenges methodically, researchers can achieve reliable functional expression and accurate characterization of TAS2R7.

How does the metal ion sensitivity of TAS2R7 compare between recombinant systems and native taste cells?

  • Comparative calcium imaging: Perform parallel calcium imaging experiments in TAS2R7-transfected cells and isolated human taste cells exposed to the same concentrations of metal ions.

  • Gene expression correlation: Quantify TAS2R7 expression in taste tissues using qRT-PCR and in situ hybridization and correlate expression levels with sensitivity to metal ions in functional assays.

  • Receptor knockout models: Use CRISPR/Cas9 to eliminate TAS2R7 expression in taste cell models and observe changes in metal ion sensitivity.

When comparing systems, researchers should consider that heterologous expression systems may yield different sensitivities due to:

  • Different membrane compositions affecting receptor conformation

  • Variations in G protein coupling efficiency

  • Absence of taste-specific accessory proteins

  • Different post-translational modifications

Research with mouse bitter receptors has shown that expression system sensitivity can differ significantly, with some systems being more sensitive for detecting agonists with lower efficacy . These considerations suggest that quantitative differences between native and recombinant systems should be expected, highlighting the importance of validating findings across multiple experimental approaches.

What methodological approaches enable high-throughput screening for novel TAS2R7 modulators?

For researchers interested in identifying novel compounds that modulate TAS2R7 activity, these high-throughput screening approaches are recommended:

  • Automated calcium flux assays: Using TAS2R7-expressing cells in 384-well format with automated liquid handling and fluorescence plate readers to measure calcium responses following exposure to compound libraries.

  • FLIPR-based screening: Fluorescent Imaging Plate Reader systems allow simultaneous measurement of calcium flux across entire plates, enabling rapid screening of thousands of compounds.

  • Bioluminescence resonance energy transfer (BRET): By creating TAS2R7 fusion constructs with bioluminescent and fluorescent proteins, researchers can monitor receptor conformational changes upon ligand binding in real-time.

  • Receptor internalization assays: Monitoring receptor trafficking using high-content imaging systems can identify both agonists and antagonists through changes in receptor localization.

  • Competitive binding assays: Using known metal ion activators as reference ligands, researchers can identify compounds that compete for TAS2R7 binding sites.

For successful screening campaigns, researchers should:

  • Include positive controls (known metal ion activators like zinc sulfate) on each plate

  • Incorporate appropriate negative controls (monovalent salts like KCl) that don't activate TAS2R7

  • Use multiple concentrations to identify both high and low-potency modulators

  • Validate hits using secondary assays including dose-response analysis

These approaches facilitate the identification of novel compounds that may activate or inhibit TAS2R7, expanding our understanding of this receptor's pharmacology.

How should dose-response data for TAS2R7 activation be analyzed to account for metal-specific effects?

Proper analysis of dose-response data for TAS2R7 activation by metal ions requires several specific considerations:

  • Efficacy vs. potency differentiation: Metal ions may activate TAS2R7 with varying efficacies (maximum response amplitude) and potencies (EC50 values). Both parameters should be separately quantified and reported. Research has shown that different agonists can activate bitter taste receptors with widely different efficacies and potencies .

  • Normalization approaches: For comparing metal ions:

    • Normalize to a reference activator (e.g., ZnSO4) at a saturating concentration

    • Report raw fluorescence changes (ΔF/F) to maintain absolute response magnitude information

    • Calculate percentage of maximum response for each metal ion separately

  • Statistical handling of variability: Response variability tends to be heteroscedastic (variance increases with signal magnitude). Consider:

    • Using weighted fitting for dose-response curves

    • Log-transforming data before statistical analysis

    • Employing non-parametric tests when appropriate

  • Metal-specific confounding factors:

    • Account for different counterions (Cl⁻ vs. SO₄²⁻)

    • Control for pH effects across different metal salt solutions

    • Consider potential precipitation or complexation at higher concentrations

    • Evaluate potential cytotoxicity of metal ions at higher concentrations

  • Reporting threshold concentrations and EC₅₀ values: For bitter taste receptors, threshold concentrations can span 6 orders of magnitude , so both values should be reported to fully characterize the receptor's sensitivity profile.

By addressing these considerations in data analysis, researchers can generate more accurate and comparable characterizations of TAS2R7 activation by different metal ions.

What are the current contradictions or unresolved questions in the TAS2R7 research literature?

Several important contradictions and unresolved questions remain in TAS2R7 research that present opportunities for further investigation:

  • Complete agonist profile: While TAS2R7 has been established as responsive to metal ions, its complete agonist profile remains incompletely characterized. It remains unclear whether TAS2R7 responds to non-metal bitter compounds, and if so, what structural features these compounds might share.

  • Physiological relevance: The concentrations of metal ions used in experimental settings (often 20 mM) may exceed physiologically relevant concentrations in food and beverages. The threshold concentrations for activation in more natural contexts require clarification.

  • Species differences: While human TAS2R7 responds to metal ions, the response profiles of orthologous receptors in other species remain largely uncharacterized. This limits our understanding of the evolutionary significance of metal ion detection.

  • Signal transduction mechanisms: The precise G protein coupling preferences of TAS2R7 in native taste cells versus heterologous systems may differ, and the downstream signaling cascades have not been fully elucidated.

  • Structural basis for activation: While H94 and E264 have been identified as important residues , the complete structural basis for metal ion coordination, including potential involvement of water molecules or other residues, requires further investigation.

  • Regulatory mechanisms: Potential regulation of TAS2R7 expression and function through desensitization, internalization, or other feedback mechanisms remains poorly understood.

Addressing these contradictions and unresolved questions represents an important frontier in TAS2R7 research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.