Recombinant Human Taste receptor type 2 member 8 (TAS2R8)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Human TAS2R8 is a genetically engineered form of the bitter taste receptor TAS2R8, a G-protein coupled receptor (GPCR) encoded by the TAS2R8 gene in humans. This receptor is part of the TAS2R family, which mediates bitter taste perception and has broader physiological roles beyond gustation . Recombinant production enables large-scale synthesis for research and therapeutic applications, leveraging heterologous expression systems to study its structure, function, and ligand interactions .

Functional Roles and Mechanisms

TAS2R8 is canonically expressed in taste buds but is also found in extraoral tissues, including the respiratory, digestive, and genitourinary systems, as well as cancer cells . Its activation triggers intracellular calcium signaling via G-protein gustducin, phospholipase Cβ2 (PLCβ2), and TRPM5 channels . Key roles include:

  • Bitter Taste Perception: Detects noxious substances, triggering aversive responses .

  • Anti-Cancer Activity: Inhibits cancer stemness, migration, and invasion in neuroblastoma (NB) cells by downregulating markers like DLK1, CD133, and HIF-1α .

  • Immune Modulation: Polymorphisms in TAS2R8 are linked to glioma susceptibility and autoimmune responses .

Therapeutic Potential in Oncology

Studies highlight TAS2R8’s role in suppressing tumorigenicity and metastasis:

  • Overexpression reduces matrix metalloproteinase (MMP) activity and HIF-1α-driven pathways .

  • Acts as a biomarker for basal-like breast cancer (BLBC), with 33% sensitivity and 98% specificity when combined with other autoantibodies .

Key Studies

Study FocusMethodology & FindingsSource
Neuroblastoma InhibitionTAS2R8 overexpression suppressed CSC markers, self-renewal, and tumorigenicity in vitro.
Glioma SusceptibilityTAS2R8 SNPs identified as risk factors through pathway analysis of GWAS data.
BLBC DiagnosisTAS2R8 autoantibodies distinguished BLBC from controls with high specificity.

Production and Technical Challenges

Recombinant TAS2R8 is produced using platforms like Creative Biolabs’ Magic™ system, which optimizes membrane protein expression in mammalian or insect cell lines . Challenges include:

  • Structural Complexity: Requires stabilization of 7-transmembrane domains .

  • Functional Validation: Ligand-binding assays (e.g., calcium flux measurements) confirm receptor activity .

Genetic Variability and Functional Impact

TAS2R8 exhibits polymorphisms affecting bitter perception and disease susceptibility. For example:

  • A Korean patent (KR20180113426A) links TAS2R8 expression levels to cancer prognosis and therapy .

  • Global genomic analyses reveal rare functional variants influencing receptor activation thresholds .

Future Directions

  • Drug Development: Targeting TAS2R8 with bitter agonists for chemoprevention or adjuvant therapy .

  • Personalized Medicine: Leveraging genetic variability to predict bitter compound metabolism or cancer risk .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request as closely as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate with us and we will prioritize developing the specified tag.
Synonyms
TAS2R8; Taste receptor type 2 member 8; T2R8; Taste receptor family B member 5; TRB5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTVDYILTNLVIARICLIS VMVVNGIVIVLNPDVYTKNKQQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFL WLKWKIDMVVHWILLGCFAISLLVSLIAAIVLSCDYRFHAIAKHKRNITEMFHVSKIPYF EPLTLFNLFAIVPFIVSLISFFLLVRSLWRHTKQIKLYATGSRDPSTEVHVRAIKTMTSF IFFFFLYYISSILMTFSYLMTKYKLAVEFGEIAAILYPLGHSLILIVLNNKLRQTFVRML TCRKIACMI
Uniprot No.

Target Background

Function
This receptor is believed to play a role in the perception of bitterness and is linked to gustducin. It may contribute to sensing the chemical composition of the gastrointestinal contents. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Gene References Into Functions
  1. Targets cancer stem cells by suppressing cancer stemness characteristics and neuroblastoma cell invasion PMID: 28467517
  2. Human bitter taste receptors hTAS2R8 and hTAS2R39 exhibit differential functions in recognizing bitter peptides. PMID: 21670512
Database Links

HGNC: 14915

OMIM: 604794

KEGG: hsa:50836

STRING: 9606.ENSP00000240615

UniGene: Hs.533755

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.

Q&A

What is TAS2R8 and what is its function?

TAS2R8 (taste 2 receptor member 8) is a protein-coding gene that belongs to the family of candidate taste receptors within the G-protein-coupled receptor superfamily. It encodes a receptor that plays a crucial role in the perception of bitterness and is gustducin-linked. The protein is specifically expressed in the taste receptor cells of the tongue and palate epithelia. Beyond taste perception, TAS2R8 may also function in sensing the chemical composition of gastrointestinal content, suggesting broader physiological roles than initially understood . The receptor's activation can stimulate alpha gustducin, mediate phospholipase C-beta-2 (PLC-beta-2) activation, and lead to the gating of transient receptor potential cation channel subfamily M member 5 (TRPM5), which are crucial steps in the bitter taste signaling pathway .

What are the structural characteristics of TAS2R8?

TAS2R8 is encoded by a single exon gene located on chromosome 12p13.2 . The protein consists of 311 amino acids forming a seven-transmembrane G-protein-coupled receptor structure typical of taste receptors. Its full amino acid sequence has been determined and is available in protein databases under UniProt ID Q9NYW2 . The receptor contains multiple transmembrane domains that anchor it to the cell membrane, with specific regions involved in ligand binding and signal transduction. As a membrane protein, TAS2R8 has both extracellular domains that interact with bitter compounds and intracellular domains that couple with G-proteins to initiate downstream signaling cascades .

How is TAS2R8 genomically organized and what are its known variants?

TAS2R8 is located on chromosome 12p13.2 and spans the genomic coordinates 10806051 to 10807286 on the complement strand (NC_000012.12) . The gene is organized in the genome in clusters with other taste receptors, which is a common arrangement for bitter taste receptor genes. This clustering may facilitate coordinated expression and evolutionary adaptation to different bitter compounds. Genetic variants of TAS2R8 can be explored using resources like ClinVar and dbVar, which catalog human genetic variations and their potential relationships with phenotypes . The gene's organization in receptor clusters is genetically linked to loci that influence bitter perception in both mice and humans, suggesting evolutionary conservation of this sensory mechanism .

What experimental models are appropriate for studying TAS2R8?

When studying TAS2R8, researchers can utilize multiple experimental models. Cell-based systems include heterologous expression in HEK293 or CHO cells, which allows for functional characterization through calcium imaging or electrophysiological recordings. Primary cell cultures from human taste papillae can provide insights into native receptor function. For in vivo studies, humanized mouse models expressing human TAS2R8 are valuable for behavioral and physiological analyses. Organoids derived from human lingual or gastrointestinal tissues can serve as three-dimensional models that better recapitulate the cellular environment . Immunohistochemistry using specific antibodies like PACO01575 allows for localization studies in various tissues . When selecting a model system, researchers should consider the specific research question, as each model has advantages for particular aspects of TAS2R8 biology, from molecular interactions to systemic responses.

How does TAS2R8 signaling integrate with other taste pathways?

TAS2R8 signaling involves complex integration with multiple taste pathways through shared downstream effectors. Upon activation by bitter compounds, TAS2R8 couples with gustducin, a taste-specific G-protein, triggering a signaling cascade that includes PLC-beta-2 activation . This leads to the release of intracellular calcium and subsequent activation of TRPM5 channels. Interestingly, components of this pathway, particularly gustducin and TRPM5, are also involved in other taste modalities, suggesting cross-talk between bitter perception and other taste sensations. Advanced calcium imaging techniques with temporal resolution can reveal how TAS2R8 activation influences broader taste signaling networks. Some evidence indicates that TAS2R8 may form heterodimers with other taste receptors, potentially modulating their function and expanding the receptor's signaling capabilities beyond simple bitter compound detection . Understanding these interactions is crucial for interpreting how taste perception integrates multiple sensory inputs.

What are the implications of TAS2R8 expression in non-gustatory tissues?

The discovery of TAS2R8 expression in tissues beyond the oral cavity has significant implications for understanding its broader physiological roles. The receptor is expressed in gastrointestinal tissues where it may function in chemosensing, potentially regulating digestive processes and nutrient absorption in response to bitter compounds . This extra-oral expression suggests TAS2R8 may participate in defensive mechanisms against potentially harmful substances, triggering protective responses such as reduced gut motility or increased mucus secretion. Research indicates possible expression in respiratory epithelia, where bitter taste receptors may contribute to pathogen detection and immune responses. Advanced single-cell RNA sequencing has revealed cell-type specific expression patterns in these non-gustatory tissues, providing insights into the receptor's diverse functions . Understanding these extra-oral roles may open new therapeutic avenues for gastrointestinal and respiratory disorders through targeted modulation of TAS2R8 activity.

How do genetic polymorphisms in TAS2R8 affect bitter taste perception?

Genetic polymorphisms in TAS2R8 contribute significantly to individual differences in bitter taste perception, with implications for food preferences and potentially dietary health. Single nucleotide polymorphisms (SNPs) in the TAS2R8 coding region can alter the receptor's binding affinity for specific bitter compounds or its coupling efficiency with downstream signaling components. Association studies have linked certain TAS2R8 variants with altered sensitivity to specific bitter compounds, though these studies require careful control for population stratification and environmental factors . Functional genomics approaches using site-directed mutagenesis can determine how specific amino acid substitutions affect receptor function. Recent advances in structural biology have begun to elucidate how polymorphisms in the binding pocket influence ligand recognition. Understanding the functional consequences of TAS2R8 genetic variation provides insights into the evolution of taste perception and may explain population differences in dietary preferences and aversions to bitter compounds.

What is the role of TAS2R8 in human disease and potential therapeutic applications?

Emerging research suggests TAS2R8 may have implications in various disease states beyond taste disorders. Changes in TAS2R8 expression or function have been observed in gastrointestinal disorders, potentially contributing to altered nutrient sensing and digestive function. Some studies suggest associations between TAS2R8 variants and susceptibility to respiratory infections, possibly through the receptor's role in pathogen detection. The receptor's involvement in nutrient sensing pathways positions it as a potential target for managing metabolic disorders, where modulation of taste perception could influence dietary choices . Development of selective TAS2R8 agonists or antagonists may provide therapeutic tools for conditions ranging from appetite disorders to respiratory diseases. Investigation of TAS2R8 in disease contexts requires integrating genetic, molecular, and clinical approaches to establish causal relationships rather than mere associations. As research advances, TAS2R8-targeted therapeutics may emerge as novel interventions for conditions where bitter taste sensing pathways play contributory roles.

What are effective methods for producing recombinant TAS2R8 protein?

Production of recombinant TAS2R8 presents unique challenges due to its hydrophobic nature as a seven-transmembrane protein. Effective expression systems include mammalian cell lines (HEK293, CHO) which provide appropriate post-translational modifications and membrane insertion. Baculovirus-insect cell systems offer high yields while maintaining proper folding. For structural studies, yeast expression (Pichia pastoris) can be optimized with specific fusion tags (e.g., BRIL, T4 lysozyme) to enhance stability and crystallization properties. Critical optimization parameters include codon optimization for the expression system, temperature modulation (typically 16-30°C), and induction conditions. Purification typically employs affinity chromatography via N- or C-terminal tags (His, FLAG, or STREP), followed by size exclusion chromatography to ensure homogeneity . Detergent selection is crucial, with mild detergents like DDM or LMNG often yielding functional protein. Validation of recombinant TAS2R8 should include Western blotting with specific antibodies such as PACO01575, circular dichroism to assess secondary structure, and functional assays measuring ligand binding or downstream signaling activation .

How can researchers effectively detect and quantify TAS2R8 expression?

Multiple complementary approaches enable robust detection and quantification of TAS2R8 expression. At the transcript level, quantitative RT-PCR using validated primer sets spanning exon boundaries provides sensitive detection of TAS2R8 mRNA. Digital droplet PCR offers absolute quantification with higher precision for low-abundance transcripts. RNA-seq with sufficient depth can reveal expression patterns across different tissues and cell types. For protein detection, Western blotting using specific antibodies like PACO01575 allows semi-quantitative analysis of TAS2R8 protein levels . Immunohistochemistry or immunofluorescence enables visualization of spatial expression patterns within tissues. For precise quantification, targeted proteomics approaches using selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) can detect and quantify specific TAS2R8 peptides. Flow cytometry with fluorophore-conjugated antibodies enables quantification at the single-cell level. When applying these techniques, researchers should include appropriate positive controls (e.g., taste tissue samples) and negative controls (tissues known not to express TAS2R8) to validate specificity and sensitivity.

What are the best approaches for identifying TAS2R8 ligands and modulators?

Identifying ligands and modulators of TAS2R8 requires systematic screening approaches combined with validation strategies. High-throughput screening using cell-based assays with calcium-sensitive dyes or reporter systems can efficiently test compound libraries for potential agonists or antagonists. Virtual screening using homology models of TAS2R8's binding pocket can prioritize compounds for experimental testing based on predicted binding energies and interactions. Molecular dynamic simulations further refine understanding of ligand-receptor interactions. Structure-activity relationship studies help identify chemical features critical for TAS2R8 activation or inhibition. For natural product discovery, bioassay-guided fractionation of plant extracts known to contain bitter compounds can yield novel TAS2R8 modulators . Validation of hits should include concentration-response curves, selectivity testing against other TAS2R family members, and confirmation in different assay formats. Advanced techniques like surface plasmon resonance or isothermal titration calorimetry can characterize binding kinetics and thermodynamics. Receptor mutagenesis studies can identify specific residues involved in ligand recognition, providing insights into binding mechanisms and facilitating rational design of more potent or selective modulators.

How should researchers interpret conflicting data on TAS2R8 expression patterns?

When faced with conflicting data regarding TAS2R8 expression patterns across different studies, researchers should systematically evaluate several factors that may contribute to these discrepancies. Tissue and cell specificity is a primary consideration, as TAS2R8 may be expressed in specific cell subpopulations that could be diluted in whole-tissue analyses . Methodology sensitivity varies significantly between techniques (qPCR, RNA-seq, proteomics), with differences in detection thresholds potentially explaining contradictory results. Antibody specificity is particularly critical when interpreting immunohistochemistry or Western blot data, as cross-reactivity with other TAS2R family members can occur due to sequence homology . Sample preparation and handling can affect mRNA and protein stability, potentially leading to false negatives in certain preparations. To reconcile conflicting data, researchers should implement multiple detection methods on the same samples, perform careful antibody validation including knockout controls, use single-cell approaches to identify cell-specific expression patterns, and consider developmental timing and physiological state, as TAS2R8 expression may be dynamically regulated under different conditions.

How can researchers integrate multi-omics data to understand TAS2R8 function?

Integrating multi-omics data provides a comprehensive understanding of TAS2R8 function beyond what any single approach can reveal. Genomics data identifies regulatory regions and genetic variants affecting TAS2R8 expression or function, while transcriptomics captures expression patterns across tissues and conditions, including alternative splicing events. Proteomics confirms actual protein expression and can identify post-translational modifications that may regulate TAS2R8 activity. Metabolomics can reveal changes in cellular metabolism following TAS2R8 activation, providing insights into downstream effects. Integration strategies include co-expression network analysis to identify genes with similar expression patterns to TAS2R8, suggesting functional relationships. Pathway enrichment across multiple omics layers can highlight consistently affected biological processes. Causal network reconstruction using Bayesian approaches can establish directionality between molecular changes. Visualization tools like Circos plots or heatmaps can effectively display relationships across different data types. When implementing multi-omics integration, temporal aspects should be considered, as different molecular changes occur on varying timescales following receptor activation. This integrated approach allows researchers to develop comprehensive models of TAS2R8 function that capture both immediate signaling events and longer-term physiological responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.