Recombinant Human TBC1 domain family member 20 (TBC1D20)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TBC1D20; C20orf140; TBC1 domain family member 20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TBC1D20
Target Protein Sequence
MALRSAQGDGPTSGHWDGGAEKADFNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGL LTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQRE GLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDP TMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYD FFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFV QFPPSELAREAAAQQQAERTAASTFKDFELASAQQRPDMVLRQRFRGLLRPEDRTKDVLT KPRTNRFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQLFP
Uniprot No.

Target Background

Function

Recombinant Human TBC1 domain family member 20 (TBC1D20) is a GTPase-activating protein (GAP) specific to the Rab1 and Rab2 small GTPase families. It significantly accelerates the intrinsic GTP hydrolysis rate of these GTPases by more than five orders of magnitude.

Gene References Into Functions

Functional Significance of TBC1D20:

  1. TBC1D20 deficiency is implicated in Warburg Micro syndrome. PMID: 26063829
  2. Loss-of-function mutations in TBC1D20 are associated with cataracts and male infertility in mice, and Warburg micro syndrome in humans. PMID: 24239381
  3. The interaction between NS5A, TBC1D20, and Rab1 is crucial for the viral life cycle. PMID: 22491470
  4. TBC1D20 is involved in regulating the HIV replication cycle. PMID: 22260459
  5. TBC1D20 is the first known GAP for Rab1, which plays a role in regulating anterograde trafficking between the endoplasmic reticulum and the Golgi complex. PMID: 17901050
Database Links

HGNC: 16133

OMIM: 611663

KEGG: hsa:128637

STRING: 9606.ENSP00000346139

UniGene: Hs.590876

Involvement In Disease
Warburg micro syndrome 4 (WARBM4)
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What disease models are associated with TBC1D20 dysfunction, and how are they experimentally utilized?

TBC1D20 dysfunction is associated with several disease models that provide valuable experimental platforms:

ModelOriginPhenotypesResearch Applications
blind sterile (bs) mouseSpontaneous mutationCataracts, male infertility, female fertility defectsMechanistic studies of TBC1D20 loss-of-function
Tbc1d20−/− mouseEngineered knockoutEye abnormalities, reproductive defectsTissue-specific function analysis
WARBM patient cellsPatient-derivedCellular defects in vesicular traffickingHuman disease modeling

The bs mouse model has been particularly valuable for studying TBC1D20 function. This model exhibits nuclear cataracts and male infertility, with a causative mutation in the Tbc1d20 gene . For researchers, these models offer complementary approaches to investigate tissue-specific roles of TBC1D20, with methods including:

  • Phenotypic characterization across different tissues

  • Isolation of primary cells (MEFs, Sertoli cells, uterine stromal cells)

  • Histological and molecular analysis of affected tissues

  • Rescue experiments with wild-type TBC1D20

When designing experiments using these models, researchers should consider that TBC1D20 deficiency can affect multiple cellular pathways, requiring careful experimental controls to distinguish primary from secondary effects .

How does TBC1D20 regulate autophagy, and what methods are optimal for studying this function?

TBC1D20 serves as a key regulator of autophagosome maturation through its RAB1B GAP function. The experimental evidence demonstrates that:

  • TBC1D20-deficient cells show accumulated LC3-II and SQSTM1/p62 proteins, indicating disrupted autophagic flux

  • RAB1B colocalizes with LC3 on autophagosomes in both wild-type and TBC1D20-deficient cells

  • TBC1D20 regulates autophagosome maturation through RAB1B inactivation

Recommended methodological approaches for studying TBC1D20's role in autophagy include:

  • Autophagic flux assays: Monitor LC3-II turnover with and without lysosomal inhibitors (bafilomycin A1) by immunoblotting

  • Colocalization studies: Examine association of RAB1B and LC3 using fluorescently tagged proteins

  • Live cell imaging: Track autophagosome formation and maturation using GFP-LC3 and lysosomal markers

  • Electron microscopy: Quantify autophagosome and autolysosome numbers and morphology

  • Protein degradation assays: Measure long-lived protein turnover to assess functional autophagy

When interpreting results, researchers should be aware that autophagy defects observed in TBC1D20-deficient cells might also be influenced by endoplasmic reticulum stress, as evidenced by altered expression of stress markers like BIP and PDI .

What molecular mechanisms explain TBC1D20's role in both ocular and reproductive phenotypes?

TBC1D20 deficiency causes seemingly diverse phenotypes that are united by common underlying molecular mechanisms:

TissuePhenotypeMolecular Mechanism
Eye LensCataractsDisrupted autophagy preventing clearance of damaged proteins in lens fiber cells
TestesMale infertilityImpaired autophagosome maturation affecting Sertoli cell function and acrosome formation
UterusFemale infertilityReduced uterine size, impaired decidualization, and endoplasmic reticulum stress
BrainNeurodevelopmental defects (in WARBM)Altered neuronal autophagic flux

The molecular link between these phenotypes appears to be:

  • TBC1D20-mediated regulation of RAB1/RAB18 affects essential vesicular trafficking pathways

  • Disruption leads to both autophagy defects and endoplasmic reticulum stress

  • These cellular processes are particularly critical in tissues with high protein turnover or specialized membrane remodeling

When designing experiments to investigate tissue-specific phenotypes, researchers should employ comparative approaches across tissues, including:

  • Quantitative proteomics to identify tissue-specific TBC1D20 interactors

  • Phosphorylation analysis to detect differential regulation

  • Transcriptomic profiling to identify tissue-specific responses to TBC1D20 deficiency

How can researchers optimize expression and purification of recombinant TBC1D20 for functional studies?

Recombinant TBC1D20 production requires careful optimization for reliable functional studies:

Expression System Considerations:

  • E. coli is commonly used for full-length human TBC1D20 expression with N-terminal His-tags

  • Consider alternative expression systems (insect cells, mammalian cells) if membrane association is critical

Purification Protocol:

  • Express full-length protein (1-403aa) fused to N-terminal His-tag in E. coli

  • Harvest cells and lyse using appropriate buffer systems

  • Purify using Ni-NTA affinity chromatography

  • Perform quality control via SDS-PAGE (purity >90%)

  • Lyophilize in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Reconstitution Recommendations:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% recommended)

  • Aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Activity Verification:

  • GAP activity assays with purified RAB1B and RAB2A

  • Structural integrity assessment via circular dichroism

  • Thermal stability analysis to ensure proper folding

What are the latest findings regarding TBC1D20's role in female reproductive biology?

Recent research has revealed essential roles for TBC1D20 in female reproductive biology:

Key Findings:

  • Female Tbc1d20−/− mice are infertile

  • TBC1D20 is required for normal postnatal uterine development

  • Tbc1d20−/− mice show marked reduction in uterine size and weight

  • Limitations in myometrial thickness, endometrial gland numbers, and blood vessel density are observed

  • Impaired uterine decidualization occurs in vivo and in vitro

Hormonal Effects:

  • Altered levels of steroidal sex hormones including estrogen (E2), progesterone (P4), and follicle-stimulating hormone (FSH) in Tbc1d20−/− mice

Cellular Mechanisms:

  • TBC1D20 deficiency retards proliferation and differentiation of uterine stromal cells

  • TBC1D20 loss triggers endoplasmic reticulum stress in proliferating and differentiating uterine stromal cells

  • Decreased expression of BIP and PDI in Tbc1d20−/− endometrial stromal cells

  • Reduced expression of key decidualization factors (Bmp2, Bmp4, Hoxa10, Pgr, Wnt4) in Tbc1d20−/− mice

For researchers investigating TBC1D20 in female reproduction, recommended methodologies include:

  • Bilateral ovarian removal models to separate ovarian from uterine effects

  • Artificial induced decidualization models in vivo and in vitro

  • Primary uterine stromal cell isolation for molecular analyses

  • Immunohistochemistry to assess tissue architecture and marker expression

How do we distinguish between TBC1D20's effects via RAB1 versus RAB18 regulation?

Differentiating between TBC1D20's effects on different RAB GTPases requires sophisticated experimental approaches:

Experimental Strategies:

  • Substrate-specific GAP activity assays:

    • Compare TBC1D20's GAP activity toward purified RAB1B, RAB2A, and RAB18

    • Measure GTP hydrolysis rates in controlled biochemical assays

  • RAB-specific rescue experiments:

    • Express constitutively active (GTP-locked) or dominant negative (GDP-locked) RAB mutants

    • Determine which RAB GTPase variant rescues specific TBC1D20-deficient phenotypes

  • Pathway-specific functional assays:

    • RAB1: Monitor ER-to-Golgi trafficking, Golgi integrity

    • RAB18: Assess lipid droplet formation, endoplasmic reticulum organization

  • Protein-protein interaction studies:

    • Use co-immunoprecipitation to determine direct interactions

    • Employ proximity ligation assays to visualize TBC1D20-RAB interactions in situ

  • Tissue-specific expression analysis:

    • Quantify RAB1 versus RAB18 expression across tissues

    • Correlate with phenotypic severity in TBC1D20-deficient models

Current evidence suggests TBC1D20 primarily regulates RAB1B and RAB2A in cellular trafficking, while its effects on RAB18 may be more relevant to Warburg micro syndrome pathology .

What methodological approaches are most effective for studying TBC1D20's role in endoplasmic reticulum stress?

TBC1D20 deficiency induces endoplasmic reticulum (ER) stress across multiple cell types, requiring specific methodological approaches:

Recommended Methods:

TechniqueApplicationMarkers/Readouts
ImmunoblottingQuantification of ER stress markersBIP/GRP78, PDI, CHOP, phospho-PERK, phospho-eIF2α
qRT-PCRTranscriptional changes in UPR genesXBP1 splicing, ATF4, ATF6, CHOP
ImmunofluorescenceVisualization of ER morphologyCalnexin, calreticulin, PDI staining
ER calcium imagingER calcium homeostasisFura-2AM, D1ER FRET probes
Electron microscopyUltrastructural ER changesER dilation, ribosome association
RNA-seqGlobal transcriptional responseUPR pathway enrichment
Live cell imagingER dynamicsER-tracker dyes, fluorescent ER proteins

Experimental Design Considerations:

  • Include positive controls (tunicamycin, thapsigargin) in parallel

  • Compare acute versus chronic ER stress responses

  • Distinguish between UPR branches (PERK, IRE1, ATF6)

  • Consider cell type-specific variations in ER stress responses

When interpreting results, researchers should note that TBC1D20-deficient cells show decreased expression of BIP and PDI during proliferative and differentiation phases, suggesting that the protein plays a critical role in maintaining ER homeostasis across multiple cellular states .

What are the molecular interactions between TBC1D20 and viral replication machinery?

TBC1D20 has been implicated in viral replication processes, particularly for hepatitis C virus (HCV) and human immunodeficiency virus (HIV):

Key Molecular Interactions:

  • TBC1D20 functions as a RAB1 GTPase-activating protein that mediates hepatitis C virus replication

  • For HIV, TBC1D20 regulates trafficking of viral envelope proteins toward virion assembly sites via a RAB1-regulated pathway

Experimental Approaches for Studying TBC1D20-Virus Interactions:

  • Viral replication assays:

    • HCV replicon systems to measure viral RNA replication

    • HIV single-cycle infection assays with TBC1D20 knockdown/overexpression

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of TBC1D20 with viral proteins

    • Mass spectrometry to identify virus-induced changes in TBC1D20 interactome

  • Trafficking studies:

    • Live-cell imaging of fluorescently tagged viral proteins

    • Pulse-chase experiments to track viral protein movement

  • Functional domain analysis:

    • Structure-function studies with TBC1D20 mutants

    • Identification of viral protein binding domains

Understanding these interactions provides insights into both viral pathogenesis and the physiological functions of TBC1D20 .

How does TBC1D20 deficiency affect lipid droplet formation and what techniques best visualize these changes?

TBC1D20 deficiency leads to aberrant lipid droplet (LD) formation across multiple cell types:

Molecular Mechanisms:

  • TBC1D20-deficient cells show enlarged and more numerous lipid droplets

  • This phenotype is observed in mouse embryonic fibroblasts (MEFs) from bs mice

  • Similar LD abnormalities are seen in human fibroblasts deficient in TBC1D20, RAB18, or RAB3GAP1

  • Suggests a common cellular abnormality associated with Warburg Micro syndrome

Recommended Visualization Techniques:

  • Fluorescent lipid dyes:

    • BODIPY 493/503 for neutral lipid staining

    • Nile Red for phospholipid and neutral lipid differentiation

    • LipidTOX for high-specificity LD staining

  • Immunofluorescence of LD-associated proteins:

    • PLIN1-5 (perilipin family proteins)

    • DGAT1/2 (diacylglycerol acyltransferases)

    • ATGL (adipose triglyceride lipase)

  • Electron microscopy:

    • Conventional TEM for LD ultrastructure

    • Immuno-EM for protein localization to LDs

  • Live cell imaging:

    • Time-lapse microscopy to track LD dynamics

    • FRAP (fluorescence recovery after photobleaching) for protein mobility

  • Biochemical analysis:

    • Lipid extraction and quantification by mass spectrometry

    • Western blotting for LD-associated proteins

Data Analysis Approaches:

  • Quantify LD number, size distribution, and total area per cell

  • Assess LD clustering and subcellular distribution

  • Measure lipid composition changes

  • Evaluate protein recruitment to LDs

These findings suggest that abnormal lipid metabolism may be a common cellular abnormality in WARBM, although it remains unclear whether these abnormalities directly contribute to disease pathology .

What are the emerging roles of TBC1D20 in neurodevelopment and neurodegeneration?

TBC1D20 has significant implications for neural development and function:

Neurodevelopmental Roles:

  • TBC1D20 mutations cause brain abnormalities in Warburg Micro syndrome

  • TBC1D20-deficient mice, while not fully recapitulating severe human developmental brain abnormalities, display disrupted neuronal autophagic flux

  • This disruption results in adult-onset motor dysfunction

Neuronal Function Impacts:

  • Altered vesicular trafficking affects neurotransmitter release

  • Disrupted autophagy leads to protein aggregation

  • Endoplasmic reticulum stress contributes to neuronal dysfunction

Research Methodologies:

  • Neuronal culture systems:

    • Primary neurons from TBC1D20-deficient models

    • iPSC-derived neurons from WARBM patients

  • Behavioral assays in animal models:

    • Motor function tests (rotarod, grip strength)

    • Cognitive assessments (maze tasks, fear conditioning)

  • Electrophysiological approaches:

    • Patch-clamp recordings of neuronal activity

    • Field potential recordings in brain slices

  • Imaging techniques:

    • High-resolution imaging of neuronal morphology

    • Live imaging of vesicular trafficking in neurons

  • Molecular analyses:

    • Assessment of protein aggregation

    • Measurement of autophagic flux in neurons

The connection between TBC1D20-mediated autophagy and neurodegeneration provides a promising area for further research, potentially linking basic cellular functions to complex neurological phenotypes .

What methodological challenges exist in studying TBC1D20's role in vesicle trafficking?

Investigating TBC1D20's role in vesicle trafficking presents several methodological challenges:

Technical Challenges and Solutions:

ChallengeDescriptionMethodological Solutions
Membrane associationTBC1D20 is an ER-embedded proteinUse detergent-solubilized preparations or membrane fractions
Multiple RAB targetsTBC1D20 acts on both RAB1 and RAB18Design RAB-specific assays with mutant controls
Dynamic trafficking eventsVesicular movement occurs rapidlyEmploy high-speed live cell imaging techniques
Redundancy with other GAPsOther TBC proteins may compensateUse combinatorial knockdown/knockout approaches
Context-dependent activityActivity varies by cell type/conditionStudy in multiple cell types under varied conditions

Advanced Approaches:

  • RUSH system (Retention Using Selective Hooks):

    • Allows synchronized release of cargo proteins

    • Enables precise timing of trafficking events

  • CRISPR-mediated endogenous tagging:

    • Labels endogenous TBC1D20 and RAB proteins

    • Preserves physiological expression levels

  • Super-resolution microscopy:

    • Techniques like STORM, PALM, or STED

    • Resolves vesicular structures beyond diffraction limit

  • Correlative light and electron microscopy (CLEM):

    • Combines fluorescence and ultrastructural information

    • Identifies exact location of trafficking events

  • Proximity labeling approaches:

    • BioID or APEX2 fusions to TBC1D20

    • Identifies proximal proteins in living cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.