Recombinant Human Testis-specific protein TEX28 (TEX28)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing. If you require a specific tag, please inform us, and we will prioritize its incorporation.
The tag type will be determined during the production process. Please specify your tag requirements for preferential development.
Synonyms
TEX28; CXorf2; TEX28P1; TEX28P2; Testis-specific protein TEX28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-410
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TEX28
Target Protein Sequence
MVLKAEHTRSPSATLPSNVPSCRSLSSSEDGPSGPSSLADGGLAHNLQDSVRHRILYLSE QLRVEKASRDGNTVSYLKLVSKADRHQVPHIQQAFEKVNQRASATIAQIEHRLHQCHQQL QELEEGCRPEGLLLMAESDPANCEPPSEKALLSEPPEPGGEDGPVNLPHASRPFILESRF QSLQQGTCLETEDVAQQQNLLLQKVKAELEEAKRFHISLQESYHSLKERSLTDLQLLLES LQEEKCRQALMEEQVNGRLQGQLNEIYNLKHNLACSEERMAYLSYERAKEIWEITETFKS RISKLEMLQQVTQLEAAEHLQSRPPQMLFKFLSPRLSLATVLLVFVSTLCACPSSLISSR LCTCTMLMLIGLGVLAWQRWRAIPATDWQEWVPSRCRLYSKDSGPPADGP
Uniprot No.

Target Background

Gene References Into Functions
  1. Proposed structure of the second gene in 3-gene arrays (Green-pTEX-Green-pTEX-Green-fTEX and Red-pTEX-Red-pTEX-Red-fTEX) in color-vision-deficient subjects. (PMID: 15378397)
  2. TEX28 gene copy number variations (CNVs) are associated with MYP1 X-linked myopia phenotypes. (PMID: 19098318)
Database Links

HGNC: 2563

OMIM: 300092

KEGG: hsa:1527

STRING: 9606.ENSP00000358957

UniGene: Hs.672606

Protein Families
TEX28 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Testis specific.

Q&A

What is TEX28 and what genomic location does it occupy?

TEX28 (Testis-expressed gene 28) is a nested, intercalated gene within the red-green opsin cone pigment gene tandem array on chromosome Xq28. The protein is also known as TEX28p, hTEX28, and O15482. It belongs to the broader family of testis-expressed genes that play significant roles in reproduction and spermatogenesis across mammals . The gene's strategic position within the opsin array has important implications for both its function and the technical approaches required for its study, particularly when considering potential copy number variations that may occur in this genomic region .

What is the tissue expression pattern of TEX28?

While TEX28 was initially identified as a testis-expressed gene, research has revealed a more diverse expression pattern. Expression profiling through RT-PCR has demonstrated TEX28 expression in blood, kidney, and testis among non-ocular tissues. Within ocular tissues, expression has been detected in the retina, sclera, cornea, optic nerve, and trabecular meshwork . This multi-tissue expression pattern suggests broader physiological roles beyond reproductive functions and necessitates tissue-specific research approaches when studying TEX28 in different biological contexts.

What techniques are optimal for detecting TEX28 copy number variations?

For detecting TEX28 copy number variations (CNVs), a multi-method approach is recommended:

  • Ultra-high resolution array-comparative genomic hybridization (array-CGH) assays comparing subject genomic DNA with control samples provide initial CNV assessment.

  • Opsin or TEX28 gene-targeted quantitative real-time gene expression assays (comparative CT method) can validate array-CGH findings.

  • For analysis of array-CGH microarray data, DNA segmentation analysis of averaged log₂ ratios using circular binary segmentation algorithms is effective, with calls typically made when P < 0.01 .

These complementary approaches have successfully identified that while only three copies of TEX28 were previously reported within the opsin array, affected individuals may have fewer (one) or more (four or five) copies than unaffected individuals, highlighting the importance of precise copy number assessment in disease research .

What are the recommended methods for TEX28 gene expression analysis?

For comprehensive TEX28 expression analysis:

  • RNA extraction should be performed promptly from fresh tissue samples (stored in RNA preservation solutions like RNAlater within 4-6 hours of collection).

  • Tissue-specific isolation techniques are important - for ocular tissues, fine dissection of 6-mm trephine punches from specific regions (e.g., posterior pole for myopia studies) is recommended.

  • Standard RNA isolation protocols (e.g., Ribopure kit) followed by cDNA conversion provide reliable templates for downstream analysis.

  • PCR amplifications with TEX28-specific primers and visualization by agarose gel electrophoresis, with GAPDH-specific primers as positive controls, help assess expression patterns.

  • Including non-template controls and genomic contamination checks (looking for distinct amplicons with certain primer sets) ensures result reliability .

How should sequencing of TEX28 be approached?

Effective TEX28 sequencing requires:

  • Design of primer pairs to amplify all five exons of TEX28, including 5′ and 3′ UTRs, covering 50-150 bp of each intron-exon boundary.

  • PCR amplifications using touchdown protocols with high-fidelity polymerases like Platinum Taq DNA polymerase.

  • Purification of amplicons using appropriate resin systems (e.g., Quickstep 2 SOPE Resin).

  • Sequencing reactions using standard platforms (e.g., BigDye Terminator on ABI3730 or 3100 Genetic Analyzer).

  • Sequence analysis by trimming for quality and alignment with reference sequences (e.g., UCSC Genome Browser Representative Refseq: NM001586) .

This methodical approach ensures complete coverage of the gene and reliable identification of variants that may be associated with disease phenotypes.

What is the relationship between TEX28 and X-linked myopia?

TEX28 has been investigated for its association with X-linked high-grade myopia mapped to chromosome Xq28 (MYP1 locus). Research findings indicate:

  • TEX28 copy number variations (CNVs) appear to be associated with the MYP1 X-linked myopia phenotypes.

  • In affected families with high myopia and either protanopia or deuteranopia mapped to Xq28, quantitative analysis revealed aberrant TEX28 copy numbers compared to unaffected individuals.

  • Array-CGH findings have revealed predicted duplications in patient samples with the condition.

  • The gene's location within the opsin array on Xq28 provides a biological plausibility for its involvement in visual system disorders .

The association suggests that TEX28 CNVs may contribute to the pathogenesis of X-linked high myopia, though the precise mechanisms require further investigation.

Is TEX28 implicated in neurodevelopmental disorders?

Evidence suggests that TEX28 may be involved in neurodevelopmental disorders, particularly MECP2 duplication syndrome (MDS). This syndrome is caused by tandem duplication of the MECP2 locus and its surrounding genes, including IRAK1, which is in proximity to TEX28 . The syndrome presents as a neurodevelopmental disorder, and the genomic architecture of the Xq28 region where TEX28 resides makes it susceptible to structural variations that can include neighboring genes with established neurological functions. Research in this area is ongoing, and the specific contribution of TEX28 to the phenotypic spectrum of MDS requires further clarification.

What is known about TEX28's role in male fertility?

While specific research on TEX28's direct role in male fertility is limited, insights from the broader TEX gene family indicate potential significance:

  • TEX genes generally play major roles in reproduction and spermatogenesis in humans and other mammals.

  • Related genes like TEX11 have demonstrated crucial functions in meiosis, with knockout models showing impaired spermatogenesis due to chromosomal asynapsis at the pachytene stage and defective crossover formation.

  • TEX11-deficient mice exhibit spermatocyte apoptosis at the pachytene stage and chromosome nondisjunction at the first meiotic division, leading to male infertility .

By association, TEX28 may have similar critical roles in sperm development or function, though specific mechanisms await clarification through targeted studies.

How can mouse models contribute to understanding TEX28 function?

Mouse models offer valuable insights into TEX28 function due to several factors:

  • The high observed degree of identity between human and mouse TEX genes (up to 94.07% for some TEX genes) suggests functional conservation.

  • TEX genes that are testis-specific in humans are also testis-specific in mice, indicating conserved regulatory mechanisms.

  • Successful experimentation with related genes like TEX11 in mice has elucidated critical reproductive functions - TEX11-deficient mice showed impaired spermatogenesis and male infertility.

  • Strategies used for related genes can be adapted for TEX28, including:

    • Gene knockout/knockdown approaches

    • Exon-specific deletions that create frameshift mutations

    • Domain-specific mutations to assess protein interaction capabilities

When designing mouse models for TEX28 research, consideration should be given to the gene's copy number variation in humans, potentially requiring sophisticated genetic engineering approaches to accurately model human disease states.

What are the challenges in studying TEX28 protein interactions?

Investigating TEX28 protein interactions presents several methodological challenges:

  • The nested genomic architecture within the opsin array complicates isolation of pure TEX28 for interaction studies.

  • Copy number variations mean that different individuals may express different amounts or slightly variant forms of the protein.

  • The protein's expression in multiple tissues suggests potential tissue-specific interaction partners that would require tissue-specific approaches.

  • Limited knowledge about protein domains complicates prediction of interaction partners.

Recommended approaches include:

  • Yeast two-hybrid screening with tissue-specific libraries

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity labeling techniques in relevant cell types

  • Functional genomics approaches to identify genetic interactions

Each approach must account for the possibility of tissue-specific interactions and functions of TEX28.

How should researchers interpret TEX28 copy number variation data?

Interpretation of TEX28 CNV data requires careful consideration of several factors:

Table 1: Key Considerations for TEX28 CNV Data Interpretation

FactorConsiderationMethodological Approach
Normal variationPopulation-specific differences in copy numberInclude diverse control samples
Disease associationCorrelation between CNV and phenotypeStatistical analysis with sufficient sample size
Technical variationDifferences due to methodologyUse multiple detection methods
Tissue mosaicismDifferent CNV patterns in different tissuesSample multiple tissues when possible
Genetic backgroundInfluence of other genetic factorsConsider whole genome/exome data

When analyzing TEX28 CNVs, researchers should:

  • Establish baseline copy numbers in control populations relevant to the study cohort.

  • Use multiple detection methods to confirm findings (e.g., array-CGH and quantitative PCR).

  • Apply appropriate statistical analysis, considering that in previous studies, affected individuals showed either fewer (one) or more (four or five) copies than unaffected individuals .

  • Consider the genomic context, particularly the relationship with the opsin array.

What statistical approaches are most appropriate for TEX28 genetic association studies?

For robust TEX28 genetic association studies, particularly in relation to myopia or other potential disease associations, the following statistical approaches are recommended:

  • For genotyping data analysis, the Fisher exact test has been successfully used to determine the incidence of variants (e.g., 5′ UTR SNPs) in subject DNA from unaffected males compared with affected males.

  • For array-CGH microarray data, DNA segmentation analysis of averaged log₂ ratios using circular binary segmentation algorithms with calls made when P < 0.01 provides reliable results .

  • Given the X-linked nature of TEX28, sex-stratified analyses are essential, with particular attention to hemizygous effects in males versus heterozygous effects in females.

  • Family-based association designs may be particularly powerful given the strong familial patterns observed in conditions like X-linked myopia.

  • Meta-analysis approaches combining data from multiple studies can help overcome the limitations of small sample sizes in individual studies.

How does TEX28 research integrate with broader genomic and proteomic data?

Integration of TEX28 research with broader -omics data requires sophisticated approaches:

  • Genomic integration:

    • Consider the chromosomal context of TEX28 within the opsin array on Xq28

    • Analyze linkage disequilibrium patterns with neighboring genes

    • Incorporate whole genome sequencing data to identify distant regulatory elements

  • Transcriptomic integration:

    • Analyze co-expression networks across tissues where TEX28 is expressed

    • Examine alternative splicing patterns that may be tissue-specific

    • Investigate expression quantitative trait loci (eQTLs) that may affect TEX28 expression

  • Proteomic integration:

    • Map TEX28 to protein interaction networks

    • Identify post-translational modifications that may regulate function

    • Consider structural similarities with other proteins

  • Phenomic integration:

    • Correlate TEX28 variations with detailed phenotypic data

    • Consider pleiotropy across different systems (reproductive, visual, neurological)

This multi-layered integration can provide insights into TEX28's biological roles beyond what single-approach studies can reveal.

What are the promising approaches for therapeutic targeting of TEX28-related disorders?

While therapeutic interventions targeting TEX28-related disorders are still in early conceptual stages, several approaches show promise based on our current understanding:

  • Gene therapy approaches:

    • For copy number deficiencies, AAV-mediated gene delivery

    • For excess copies, CRISPR-Cas9 based approaches to normalize copy number

    • Antisense oligonucleotides to modulate expression levels

  • Protein replacement strategies:

    • Recombinant protein delivery for loss-of-function scenarios

    • Development of tissue-specific delivery systems for affected organs

  • Targeting downstream pathways:

    • Identification and modulation of critical downstream effectors

    • Pathway-specific interventions that bypass TEX28 dysfunction

Each approach requires extensive preclinical validation before clinical translation, particularly given the complex genomic architecture of the TEX28 locus.

How might single-cell technologies advance TEX28 research?

Single-cell technologies offer unprecedented opportunities to resolve TEX28 biology at cellular resolution:

  • Single-cell RNA sequencing can:

    • Identify cell types that express TEX28 within heterogeneous tissues

    • Reveal cell state-dependent expression patterns

    • Detect rare cell populations with unique TEX28 functions

  • Single-cell ATAC-seq can:

    • Map chromatin accessibility at the TEX28 locus in different cell types

    • Identify cell-type specific regulatory elements

    • Connect transcription factor binding with expression patterns

  • Spatial transcriptomics can:

    • Localize TEX28 expression within tissue architecture

    • Identify spatial relationships with interacting partners

    • Connect expression patterns with histological features

  • Single-cell proteomics can:

    • Quantify TEX28 protein levels at single-cell resolution

    • Detect post-translational modifications

    • Map protein-protein interactions in specific cell types

These technologies will be particularly valuable for understanding TEX28 in tissues with complex cellular compositions, such as the retina and testis, where bulk measurements may obscure cell-specific functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.