Recombinant Human Testis-specific XK-related protein, Y-linked (XKRY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
XKRY; XKRY1; Testis-specific XK-related protein, Y-linked
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
XKRY
Target Protein Sequence
MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVV TLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKIIPAWWVSMDAYLNHA SICCHQFSCLSAVKLQLSNEELIRDTRWDIQSYTTDFSF
Uniprot No.

Target Background

Database Links

HGNC: 18571

OMIM: 400015

KEGG: hsa:9082

UniGene: Hs.158346

Protein Families
XK family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Testis specific.

Q&A

What is XKRY and what is its genomic location?

XKRY (XK related, Y-linked) is a probable pseudogene located in the nonrecombining portion of the Y chromosome at position Yq11.222. It is expressed specifically in testis and exists as two identical copies within a palindromic region of the Y chromosome . The gene spans the genomic coordinates 17768980 to 17770560 (complement strand) on chromosome Y (NC_000024.10) . As of March 2025, it is classified as Gene ID: 9082 in the NCBI database and is also known as XKRY1 .

XKRY shares similarity with the XK gene (X-linked Kell blood group precursor), which encodes a putative membrane transport protein . The gene consists of a single exon structure, which is relatively unusual for functional genes but common among pseudogenes . Despite its pseudogene classification, its conservation and testis-specific expression suggest potential biological significance.

How does XKRY relate to other genes in the Y chromosome?

XKRY is one of approximately 70 genes identified on the Y chromosome, many of which contribute to gonad formation, regulation of spermatogenesis, and development of various tissues including the brain, heart, and kidney . Within the Y chromosome genetic landscape, XKRY belongs to a group of genes that are:

  • Expressed specifically in the testes

  • Present in multiple copies on the NRY (Non-Recombining region of the Y)

  • Encode proteins with specialized functions

XKRY is particularly associated with the AZFb (Azoospermia Factor b) region, which is one of three non-overlapping subregions in Yq11 linked to male infertility . Other genes in this functional cluster include:

Gene SymbolFull NameExpressionPotential Function
RBMRNA-binding motifTestis-specificRNA processing in spermatogenesis
CDYChromodomain YTestis-specificChromatin modification
XKRYXK Related YTestis-specificPotential membrane transport
DAZDeleted in AzoospermiaTestis-specificRNA binding in spermatogenesis
PRYPTP-BL Related YTestis-specificProtein regulation
BPY2Basic Protein Y2Testis-specificUnknown

Unlike housekeeping genes on the Y chromosome that have X homologues, appear in single copies, and are ubiquitously expressed, XKRY belongs to the category of specialized testis-specific genes .

Why is XKRY classified as a pseudogene despite its potential functional significance?

XKRY is classified as a pseudogene primarily due to its structural characteristics, yet several lines of evidence suggest potential biological activity:

  • Single exon structure: XKRY consists of a single exon, which is often characteristic of processed pseudogenes derived from mRNA that was reverse-transcribed and reintegrated into the genome .

  • Sequence similarity to functional genes: It shows homology to the XK gene, which encodes a functional membrane transport protein, suggesting it originated from a duplicated functional gene that subsequently accumulated mutations .

  • Lack of essential functional domains: Comparative sequence analysis likely reveals frameshift mutations or premature stop codons that would prevent the translation of a full-length functional protein.

  • Evolutionary pressure: Despite its pseudogene classification, its conservation within the human lineage suggests it may still be under some selective pressure, potentially indicating regulatory functions or partial protein expression .

The testis-specific expression pattern of XKRY, despite its pseudogene status, is particularly intriguing to researchers, as it suggests the gene may still play some biological role in spermatogenesis, possibly through regulatory RNA mechanisms rather than protein coding functions .

What evidence links XKRY to spermatogenic failure?

XKRY has been associated with spermatogenic failure, particularly "Spermatogenic failure, Y-linked, 2" (MedGen: C1839071, OMIM: 415000) . The evidence linking XKRY to male infertility comes from several research approaches:

  • Deletion mapping studies: XKRY is recurrently deleted in azoospermic men, suggesting its relevance to sperm production . These deletions often occur within the broader context of AZFb region microdeletions.

  • Expression pattern analysis: XKRY is specifically expressed in adult testis, particularly in spermatogonia and primary spermatocytes, coinciding with critical stages of sperm development .

  • Comparative studies: The association of XKRY deletions with male infertility has been observed across multiple independent cohorts, strengthening the correlation between XKRY and normal spermatogenesis .

  • Functional homology: XKRY is similar to XK (X-linked Kell blood group precursor), which encodes a membrane transport protein that may be essential for proper cellular function during spermatogenesis .

While direct causation has not been definitively established through targeted gene modification studies in humans (for ethical reasons), the consistent association between XKRY deletions and male infertility provides compelling circumstantial evidence for its importance in spermatogenesis .

How does the palindromic nature of XKRY's genomic location affect research methodologies?

The presence of XKRY in two identical copies within a palindromic region poses significant methodological challenges for researchers :

  • Amplification specificity: Standard PCR approaches may amplify both copies simultaneously, making it difficult to distinguish between them. Researchers must design highly specific primers that target unique flanking sequences if they aim to study one copy independently.

  • Copy number analysis: Determining whether one or both copies are deleted in infertility cases requires quantitative approaches rather than simple presence/absence assays .

  • Mutation impact assessment: When mutations are detected, determining which copy harbors the mutation and whether it affects both copies is challenging and requires specialized techniques like fiber-FISH or long-read sequencing technologies .

  • Evolutionary analysis: The palindromic structure suggests the region underwent duplication events, which complicates phylogenetic analyses and may have functional implications for gene conversion and maintenance of sequence identity between copies .

Researchers studying XKRY must carefully design their experimental approaches to account for these challenges, often employing multiple complementary methods to verify their findings .

What are the recommended expression systems for producing recombinant XKRY protein?

Despite XKRY being classified as a pseudogene, researchers may still be interested in producing recombinant proteins for functional studies. The following expression systems can be considered, each with specific advantages for XKRY research:

  • E. coli-based expression systems:

    • Advantages: Rapid growth, high yield, cost-effective

    • Limitations: Lack of post-translational modifications, potential improper folding

    • Optimization: Codon optimization for E. coli is essential since XKRY contains human-specific codons

    • Recommended vectors: pET series with histidine tags for simplified purification

  • Mammalian expression systems (HEK293, CHO cells):

    • Advantages: Proper protein folding, post-translational modifications similar to human cells

    • Limitations: Higher cost, lower yield, longer production time

    • Recommended for: Functional studies requiring authentically processed protein

    • Vectors: pcDNA3.1 or pCMV with appropriate selection markers

  • Yeast expression systems (Pichia pastoris):

    • Advantages: Higher yields than mammalian cells, proper protein folding, some post-translational modifications

    • Limitations: Glycosylation patterns differ from human cells

    • Particularly useful for: Large-scale production of XKRY for structural studies

  • Baculovirus-insect cell system:

    • Advantages: High expression levels, proper folding, ability to express toxic proteins

    • Limitations: More complex setup, different glycosylation

    • Recommended for: Complex proteins that are difficult to express in other systems

When expressing XKRY, researchers should consider including only the potentially functional domains based on homology with the XK gene, as the full pseudogene sequence may not produce stable protein .

What purification challenges are specific to recombinant XKRY protein?

Purifying recombinant XKRY protein presents several challenges inherent to its nature as a membrane-related protein derived from a pseudogene:

  • Solubility issues: Based on its similarity to XK (a membrane transport protein), recombinant XKRY likely contains hydrophobic domains that reduce solubility :

    • Solution: Use detergents like n-dodecyl-β-D-maltoside (DDM), CHAPS, or Triton X-100 during extraction and purification

    • Alternative approach: Express only soluble domains if the full protein proves refractory to purification

  • Protein stability concerns: As a pseudogene product, XKRY may fold improperly or be unstable:

    • Stabilization strategies: Include stabilizing agents (glycerol, specific ions) in buffers

    • Storage considerations: Flash freezing aliquots and storing at -80°C to prevent degradation

    • Testing multiple constructs with various truncations to identify stable protein domains

  • Authentication challenges: Since XKRY is not normally expressed as a functional protein, confirming proper folding requires careful analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate folding quality

    • Thermal shift assays to determine stability

  • Tag interference considerations: The choice of affinity tags can affect XKRY function:

    • C-terminal tags are preferable if the N-terminus is important for function

    • Cleavable tags are recommended to remove potential interference after purification

Each purification batch should be carefully characterized for purity, stability, and batch-to-batch consistency to ensure reproducible experimental outcomes.

How do researchers distinguish between XKRY deletions and other Y chromosome abnormalities?

Distinguishing XKRY deletions from other Y chromosome abnormalities requires a multi-faceted approach:

  • Sequence-Tagged Site (STS) analysis: This PCR-based approach uses primers specific to unique Y chromosome sequences:

    • Advantages: Relatively simple to perform, widely accessible

    • Limitations: May not detect small deletions or point mutations

    • Application: Used as a first-line screening approach in many clinical studies

  • Multiplex Ligation-dependent Probe Amplification (MLPA):

    • Advantages: Detects copy number variations with higher resolution

    • Allows simultaneous analysis of multiple regions

    • Particularly useful for: Detecting partial deletions of XKRY and distinguishing them from complete AZFb region deletions

  • Microarray-based Comparative Genomic Hybridization (array-CGH):

    • Advantages: High-resolution genome-wide analysis

    • Ability to detect novel or complex rearrangements

    • Limitations: Higher cost, specialized equipment requirements

    • Essential for: Comprehensive mapping of deletion boundaries

  • Next-Generation Sequencing approaches:

    • Whole Exome Sequencing (WES): Detects point mutations in coding regions

    • Whole Genome Sequencing (WGS): Provides comprehensive coverage

    • Targeted sequencing: Cost-effective for focused analysis of Y chromosome genes

    • Particularly valuable for: Identifying previously unknown mutations or complex structural variations

  • Diagnostic decision tree for comprehensive Y chromosome analysis:

    StepMethodPurposeNext Step if PositiveNext Step if Negative
    1STS-PCRInitial screeningConfirm with MLPAProceed to NGS
    2MLPAConfirmation & extentArray-CGH for boundariesNGS for point mutations
    3NGSDetailed characterizationFunctional validationConsider other causes

Interpretation of results must consider the palindromic nature of the XKRY region and the possibility of partial deletions affecting only one copy .

What is the prevalence of XKRY deletions across different ethnic populations?

Research has revealed significant ethnic variation in the prevalence and impact of Y chromosome microdeletions involving XKRY:

These ethnic differences highlight the complex interplay between genetic background and the functional consequences of Y chromosome microdeletions involving XKRY .

What cell and animal models are most appropriate for studying XKRY function?

Despite the challenges of studying Y-chromosome genes, several model systems offer valuable insights into XKRY function:

  • Cell-based models:

    • Human testicular cell lines (GC-1, GC-2, NT2/D1):

      • Advantages: Human origin, expression of spermatogenesis-related genes

      • Limitations: May not fully recapitulate the testicular microenvironment

      • Applications: Protein localization studies, expression analysis

    • Primary testicular cell cultures:

      • Advantages: More physiologically relevant, contains multiple cell types

      • Limitations: Limited lifespan, donor variability

      • Critical for: Validating findings from immortalized cell lines

    • Induced pluripotent stem cells (iPSCs) differentiated into germline cells:

      • Advantages: Patient-specific models, developmental studies

      • Applications: Creating in vitro models of XKRY deficiency

  • Animal models:

    • Traditional rodent models have limited utility since XKRY is human-specific, but alternative approaches include:

    • Humanized mouse models:

      • Creating transgenic mice carrying human Y chromosome fragments

      • Valuable for studying XKRY in a complex organismal context

      • Limitations: Differences in spermatogenesis between species

    • Xenograft models:

      • Transplantation of human testicular tissue into immunodeficient mice

      • Permits study of human spermatogenesis in vivo

      • Useful for testing interventions to rescue XKRY-related defects

  • Organoid models:

    • Testicular organoids derived from human stem cells:

      • Advantages: 3D structure, multiple cell types, human origin

      • Applications: Testing XKRY function in a microenvironment resembling human testis

      • Developing technology with increasing relevance for reproductive biology research

  • Experimental design considerations across models:

    • Use complementary approaches (in vitro, ex vivo, in vivo)

    • Include appropriate controls (isogenic lines differing only in XKRY status)

    • Validate key findings across multiple model systems

    • Consider species differences when interpreting results

What are the most effective CRISPR-Cas9 strategies for studying XKRY function?

CRISPR-Cas9 technology offers powerful approaches for investigating XKRY function, despite challenges related to its pseudogene status and palindromic genomic context:

  • Guide RNA design considerations for XKRY:

    • Target unique regions to avoid off-target effects on related sequences

    • Account for the palindromic nature of the region by designing guides that can differentiate between copies

    • Consider the single-exon structure when positioning guide RNAs

  • Recommended CRISPR strategies for XKRY functional studies:

    ApproachDesignApplicationTechnical Considerations
    Complete knockoutMultiple gRNAs flanking XKRYAssess loss-of-function phenotypeMay affect neighboring genes
    Point mutation introductionBase editors or prime editorsStudy specific domains/motifsRequires PAM sites near target
    Epigenetic modulationdCas9 fused to modifiers (KRAB, p300)Study expression regulationDoesn't alter sequence
    Promoter modificationgRNAs targeting regulatory regionsUnderstand transcriptional controlRequires promoter identification
    TaggingHDR to add reporter genesVisualize expression & localizationRequires efficient HDR
  • Validation approaches for confirming CRISPR edits:

    • PCR amplification followed by sequencing

    • Droplet digital PCR for quantitative assessment

    • RNA-seq to confirm expression changes

    • Western blotting if antibodies are available

    • Functional assays to assess phenotypic consequences

  • Delivery methods for testicular cell applications:

    • Lentiviral vectors for stable integration

    • Adeno-associated viruses for in vivo approaches

    • Electroporation for primary cell cultures

    • Ribonucleoprotein complexes for reduced off-target effects

  • Specialized approaches for pseudogenes:

    • CRISPRi (interference) to reduce expression without sequence alteration

    • CRISPRa (activation) to test if artificial expression has functional consequences

    • RNA-targeting CRISPR systems (Cas13) if XKRY functions as a non-coding RNA

These CRISPR-Cas9 strategies must be carefully designed and validated to ensure specificity when targeting XKRY, particularly given its location in a complex genomic region .

How might single-cell technologies advance our understanding of XKRY's role in spermatogenesis?

Single-cell technologies represent a revolutionary approach to understanding genes like XKRY in the complex cellular context of spermatogenesis:

  • Single-cell RNA sequencing (scRNA-seq) applications:

    • Defining XKRY expression patterns with unprecedented cellular resolution

    • Identifying specific spermatogenic cell types expressing XKRY

    • Uncovering co-expressed gene networks to predict functional pathways

    • Comparing expression patterns between fertile and infertile men to identify dysregulated networks

  • Spatial transcriptomics for XKRY research:

    • Mapping XKRY expression within the spatial context of seminiferous tubules

    • Correlating expression with specific stages of spermatogenesis

    • Understanding cell-cell interactions influenced by XKRY

    • Techniques like Visium, MERFISH, or Slide-seq provide spatial context to expression data

  • Single-cell epigenomics for regulatory insights:

    • Single-cell ATAC-seq to identify open chromatin regions regulating XKRY

    • Single-cell ChIP-seq to map transcription factor binding at the XKRY locus

    • Single-cell DNA methylation analysis to understand epigenetic regulation

    • These approaches can reveal how XKRY regulation varies across cell types and states

  • Multiomics integration strategies:

    • Combining scRNA-seq with proteomics or metabolomics

    • CITE-seq for simultaneous measurement of RNA and protein

    • These integrated approaches can connect XKRY expression to functional outcomes

These single-cell approaches are particularly valuable for studying XKRY, as they can reveal its activity in rare cell populations and transitional states during spermatogenesis that would be missed in bulk tissue analyses .

What ethical considerations should researchers address when studying XKRY in clinical settings?

Research on XKRY and other Y chromosome genes in clinical settings raises several ethical considerations that must be carefully addressed:

  • Informed consent challenges:

    • Genetic findings may have implications for male relatives

    • Future fertility options may be affected by results

    • Recommended approach: Comprehensive genetic counseling before testing

    • Include discussion of incidental findings and future research uses of samples

  • Privacy concerns specific to Y chromosome research:

    • Y chromosome data can reveal paternal lineage and ancestry

    • Limited variation makes anonymization more challenging

    • Mitigation strategy: Strict data access controls and deidentification protocols

    • Consider special protections for Y chromosome genetic data in databases

  • Reproductive autonomy considerations:

    • Testing for XKRY deletions may influence reproductive decisions

    • Potential for directional selection against certain Y lineages through assisted reproduction

    • Ethical framework: Non-directive counseling that respects patient autonomy

    • Balance providing accurate information with avoiding genetic determinism

  • Equity and access issues:

    • Ethnicity-dependent effects require diverse research populations

    • Ensure testing is available across socioeconomic groups

    • Consider cost-effectiveness of testing in different healthcare systems

    • Develop guidelines for when testing is clinically indicated

  • Research ethics in fertility studies:

    • Special protections for recruiting infertile populations

    • Avoiding therapeutic misconception in experimental treatments

    • Transparent communication about limitations of current knowledge

    • Data sharing policies that respect participant preferences while advancing science

  • Transgenerational implications:

    • Y chromosome deletions are transmitted to 100% of male offspring born through assisted reproduction

    • Ethical framework needed for counseling about potential perpetuation of infertility

    • Long-term follow-up studies required to understand outcomes for offspring

Researchers studying XKRY should engage with bioethicists, patient advocates, and diverse stakeholders to develop context-appropriate ethical frameworks that balance scientific progress with respect for individual rights and societal values .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.