Recombinant Human Tetraspanin-10 (TSPAN10)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant Human TSPAN10

Protein Structure:

  • Gene Symbol: TSPAN10 (tetraspanin 10)

  • Molecular Weight: 36.5 kDa (predicted) .

  • Amino Acid Sequence: Comprises 326 residues, including conserved tetraspanin domains such as four transmembrane regions and a large extracellular loop (LEL) critical for protein interactions .

  • Post-Translational Modifications: Contains glycosylation sites and cysteine-rich motifs essential for tertiary structure stabilization .

Production System:

  • Expression Host: HEK293T cells .

  • Tag: C-terminal C-Myc/DDK tag for detection and purification .

  • Purity: >80% as confirmed by SDS-PAGE and Coomassie staining .

Functional Insights from Research

Role in ADAM10 Regulation:

  • TSPAN10 belongs to the TspanC8 subfamily of tetraspanins, which directly bind and regulate the maturation, trafficking, and substrate specificity of the metalloprotease ADAM10 .

  • Overexpression of TSPAN10 in cell models alters ADAM10 localization, shifting it to late endosomes and modulating its enzymatic activity .

Oxidative Stress and Pigmentation:

  • CRISPR/Cas9 knockout studies in human retinal pigment epithelium (RPE) cells revealed that TSPAN10 deficiency reduces melanosome production (p < 0.01) and tyrosinase activity, impairing pigmentation .

  • Transcriptomic analyses show TSPAN10 knockout cells exhibit dysregulated antioxidant pathways, including suppressed catalase (CAT) expression (padj = 1.39 × 10⁻²⁰), leading to heightened oxidative stress .

Osteoclastogenesis:

  • Knockdown of TSPAN10 in macrophages inhibits osteoclast formation, reducing TRAP-positive multinucleated cells and downregulating osteoclast markers like Cathepsin K .

Applications in Research

Table 1: Key Applications of Recombinant TSPAN10

Application AreaExperimental UseCitation
Protein Interaction StudiesInvestigating ADAM10 binding and maturation
Oxidative Stress ModelsAnalyzing catalase dysregulation in RPE cells
Bone RemodelingAssessing osteoclast differentiation pathways
Structural BiologyMapping tetraspanin domain interactions

Research Limitations and Future Directions

  • Limitations: Current studies primarily rely on knockout/knockdown models; recombinant TSPAN10’s direct mechanistic roles in vivo remain underexplored.

  • Future Work: Structural studies resolving TSPAN10-ADAM10 complexes and high-throughput screens for therapeutic targeting in AMD or osteoporosis.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSPAN10; OCSP; Tetraspanin-10; Tspan-10; Oculospanin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TSPAN10
Target Protein Sequence
MEEGERSPLLSQETAGQKPLSVHRPPTSGCLGPVPREDQAEAWGCSCCPPETKHQALSGT PKKGPAPSLSPGSSCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPTDP MLGLALGGLVVSAASLAGCLGALCENTCLLRGFSGGILAFLVLEAVAGALVVALWGPLQD SLEHTLRVAIAHYQDDPDLRFLLDQVQLGLRCCGAASYQDWQQNLYFNCSSPGVQACSLP ASCCIDPREDGASVNDQCGFGVLRLDADAAQRVVYLEGCGPPLRRWLRANLAASGGYAIA VVLLQGAELLLAARLLGALAARSGAAYGPGAHGEDRAGPQSPSPGAPPAAKPARG
Uniprot No.

Target Background

Function
Tetraspanin-10 (TSPAN10) is a transmembrane protein that plays a crucial role in regulating the maturation of the transmembrane metalloprotease ADAM10.
Database Links

HGNC: 29942

KEGG: hsa:83882

UniGene: Hs.208219

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the eye, including iris, ciliary body, retinal pigment epithelium, but not lens (protein level).

Q&A

What is the basic structure of human TSPAN10 protein?

Human TSPAN10 is a member of the transmembrane 4 superfamily (tetraspanin family) characterized by four hydrophobic domains that span the cell membrane. The protein has a molecular weight of approximately 36.5 kDa and is encoded by a gene located at cytogenetic position 17q25.3. TSPAN10 contains specific structural elements including extracellular domains (EC1 and EC2), four transmembrane domains, and cytoplasmic N- and C-terminal tails. Like other tetraspanins, TSPAN10's structure facilitates its function as a molecular scaffold that organizes membrane microdomains .

What are the primary tissues where TSPAN10 is expressed?

TSPAN10 demonstrates a notably specific expression pattern, with predominant expression in ocular tissues. It is found in the eye, including the iris, ciliary body, and retinal pigment epithelium (RPE), but notably absent in the lens. This expression pattern distinguishes it from some other tetraspanins that show broader tissue distribution and suggests its specialized functions in ocular physiology . Additional research has identified TSPAN10 expression in developing osteoclasts, indicating its involvement in bone remodeling processes .

How does TSPAN10 function as a molecular scaffold in cellular signaling?

TSPAN10, like other tetraspanins, functions as a molecular scaffold that organizes signaling microdomains at the cell surface. It accomplishes this by distributing proteins into highly organized tetraspanin-enriched microdomains (TEMs) consisting of adhesion molecules, signaling receptors, and adaptor proteins. This organization facilitates signal transduction events that regulate cell development, activation, growth, and motility. Specifically, TSPAN10 participates in the organization of complexes involving ADAM10, contributing to the spatial regulation of proteolytic activity within the membrane environment .

What role does TSPAN10 play in retinal pigment epithelium biology?

TSPAN10 plays crucial roles in retinal pigment epithelium (RPE) function, particularly in regulating pigmentation and oxidative stress responses. CRISPR/Cas9 mutagenesis studies have demonstrated that TSPAN10 knockout in human embryonic stem cell-derived RPE cells results in significantly reduced pigmentation and tyrosinase production. Transmission electron microscopy analysis revealed decreased melanosome numbers in TSPAN10-deficient RPE cells. Additionally, TSPAN10 knockout impairs the oxidative stress response in these cells, specifically reducing the expression and production of the antioxidative enzyme catalase. These findings suggest TSPAN10 is essential for normal RPE pigmentation and protection against oxidative damage .

How is TSPAN10 implicated in Age-Related Macular Degeneration risk?

A novel single nucleotide polymorphism (SNP) in the TSPAN10 gene has been associated with increased risk for Age-Related Macular Degeneration (AMD), a leading cause of vision loss in older adults. TSPAN10 is localized to the retinal pigment epithelium (RPE), which is a primary site of pathology in AMD. Research has demonstrated that TSPAN10 deficiency impacts key RPE functions that are relevant to AMD pathophysiology, including reduced pigmentation (which could affect light absorption and phototoxicity) and compromised oxidative stress responses (specifically through decreased catalase expression). These changes may contribute to increased susceptibility to oxidative damage, which is a central mechanism in AMD development .

What experimental approaches are optimal for studying TSPAN10 function in ocular cells?

For investigating TSPAN10 function in ocular cells, multiple complementary approaches have proven effective. CRISPR/Cas9-mediated genome editing has been successfully employed to generate TSPAN10 knockout in human embryonic stem cells (hESCs) that can be differentiated into RPE cells. This model allows for detailed characterization of TSPAN10's role in RPE development and function. Analytical methods should include morphological assessment, pigmentation quantification, trans-epithelial electrical resistance (TEER) measurement to assess barrier function, RNA sequencing for transcriptomic analysis, and protein analysis through immunostaining and western blotting. For pigmentation studies specifically, transmission electron microscopy enables precise quantification of melanosome numbers. Oxidative stress responses can be evaluated through measurement of antioxidant enzyme levels (particularly catalase) using western blotting and ELISA techniques .

How does TSPAN10 regulate ADAM10 maturation and function?

TSPAN10 belongs to the TspanC8 subfamily of tetraspanins (including Tspan5, 10, 14, 15, 17, and 33) that specifically interact with ADAM10, a transmembrane metalloprotease involved in ectodomain shedding of numerous substrates. TSPAN10 regulates ADAM10 through multiple mechanisms: First, it contributes to ADAM10 maturation by facilitating the removal of its prodomain during trafficking from the endoplasmic reticulum to the plasma membrane, which is essential for ADAM10's catalytic activity. Second, TSPAN10 stabilizes mature ADAM10 at the cell surface, regulating its abundance and availability. This association is mediated by specific domains of TSPAN10, including the EC1 domain, C-terminal tail, and palmitoylation sites. Through these mechanisms, TSPAN10 modulates ADAM10's proteolytic activity toward various substrates, potentially including amyloid precursor protein .

What is the relationship between TSPAN10, ADAM10, and Notch signaling pathways?

TSPAN10 plays a critical role in regulating Notch signaling through its modulation of ADAM10 activity. The Notch pathway requires sequential proteolytic processing, with ADAM10 mediating the initial cleavage that enables subsequent γ-secretase-mediated release of the Notch intracellular domain (NICD), which translocates to the nucleus to activate Notch target genes. In cellular studies, knockdown of TSPAN10 expression resulted in attenuated ADAM10 maturation and consequently decreased Notch activation. This was demonstrated by reduced expression of Hey1, a direct Notch target gene, indicating diminished Notch transcriptional activity. This regulatory axis appears particularly important in specific cellular contexts, including osteoclast differentiation, where TSPAN10-mediated ADAM10 maturation and subsequent Notch activation contribute to proper osteoclast formation .

How can researchers effectively distinguish between TSPAN10's direct effects and its indirect effects through ADAM10?

Distinguishing between direct TSPAN10 effects and those mediated through ADAM10 requires sophisticated experimental designs. One effective approach involves parallel knockdown experiments targeting TSPAN10 alone, ADAM10 alone, and both together, followed by comprehensive phenotypic and molecular analyses to identify overlapping and distinct outcomes. Rescue experiments can provide crucial insights—for instance, expressing ADAM10 constructs that bypass the need for TSPAN10-mediated maturation in TSPAN10-deficient cells can help determine which phenotypes are specifically due to impaired ADAM10 function. Researchers should also employ substrate-specific assays to measure ADAM10 activity toward different targets, as TSPAN10 might differentially affect ADAM10's specificity. Co-immunoprecipitation studies using deletion mutants of both proteins can map specific interaction domains and correlate structural features with functional outcomes. Finally, time-course analyses of protein trafficking and maturation using pulse-chase experiments can determine precisely which stages of ADAM10 processing are TSPAN10-dependent .

What is the function of TSPAN10 in osteoclast differentiation and bone resorption?

TSPAN10 plays a critical role in osteoclastogenesis, the process by which osteoclasts differentiate from monocyte/macrophage precursors. Studies have shown that TSPAN10 expression is upregulated during osteoclast differentiation in response to RANKL (Receptor Activator of Nuclear Factor κB Ligand), a key osteoclastogenic factor. Functional studies using shRNA-mediated TSPAN10 knockdown in osteoclast precursors demonstrated that loss of TSPAN10 dramatically inhibits osteoclast formation, as evidenced by decreased numbers of TRAP-positive multinucleated osteoclasts. At the molecular level, TSPAN10 deficiency in osteoclast lineage cells results in reduced expression of osteoclast markers including TRAP and Cathepsin K. Mechanistically, TSPAN10 regulates osteoclastogenesis, at least in part, through modulation of ADAM10 maturation and Notch signaling activation, which are important regulators of osteoclast development .

How do TSPAN10 and TSPAN5 compare in their effects on osteoclast formation?

Both TSPAN10 and TSPAN5 belong to the TspanC8 subfamily of tetraspanins and show similar patterns of upregulation during osteoclast differentiation. Knockdown studies have demonstrated that both proteins are required for proper osteoclast formation, with deficiency of either resulting in impaired osteoclastogenesis as measured by reduced formation of TRAP-positive multinucleated cells and decreased expression of osteoclast markers like TRAP and Cathepsin K. Mechanistically, both TSPAN10 and TSPAN5 regulate osteoclast formation through similar pathways involving ADAM10 maturation and Notch activation. The similar phenotypes observed when either tetraspanin is knocked down suggest they may have overlapping but non-redundant functions in osteoclast development, potentially reflecting different substrate specificities or spatial/temporal regulation of ADAM10 activity. Further comparative studies are needed to fully elucidate their distinct contributions to bone remodeling .

What experimental systems are most appropriate for studying TSPAN10's role in bone biology?

For studying TSPAN10's role in bone biology, several experimental systems have proven effective. In vitro systems using primary bone marrow-derived macrophages or RAW264.7 monocyte/macrophage cells treated with RANKL to induce osteoclast differentiation provide controllable models to investigate the molecular mechanisms of TSPAN10 function. Lentiviral transduction of shRNAs targeting TSPAN10 in these systems allows for efficient knockdown to assess loss-of-function phenotypes. For studying TSPAN10's role in osteoclast function, bone resorption assays using dentine or hydroxyapatite substrates can quantify the effects of TSPAN10 manipulation on resorptive capacity. To fully understand TSPAN10's impact on bone homeostasis, in vivo models including conditional knockout mice (using osteoclast-specific Cre recombinase systems like Cathepsin K-Cre) would be valuable for analyzing bone phenotypes through micro-CT, histomorphometry, and biomechanical testing. For mechanistic investigations connecting TSPAN10 to ADAM10 and Notch signaling in osteoclasts, techniques including co-immunoprecipitation, western blotting for mature ADAM10, and qPCR analysis of Notch target genes provide essential insights .

What are the optimal expression systems for producing functional recombinant human TSPAN10 protein?

For producing functional recombinant human TSPAN10, HEK293T mammalian expression systems have proven most effective due to their capacity for proper post-translational modifications and correct protein folding essential for tetraspanin functionality. When expressing TSPAN10, including a C-terminal tag such as Myc/DDK (FLAG) facilitates purification and detection while minimizing interference with the protein's N-terminal interactions. The optimal expression construct should contain the complete human TSPAN10 sequence (NM_031945) with proper signal peptide to ensure correct membrane insertion. Purification typically involves anti-DDK affinity columns followed by conventional chromatography steps. The resulting protein should be stored in a stabilizing buffer (e.g., 25 mM Tris-HCl, 100 mM glycine, pH 7.3, with 10% glycerol) and maintained at -80°C to preserve functionality. Quality control should include verification of purity (>80%) by SDS-PAGE with Coomassie staining and confirmation of the predicted molecular weight (approximately 36.5 kDa) .

How can researchers effectively analyze TSPAN10's interactions with other membrane proteins?

Analyzing TSPAN10's interactions with other membrane proteins requires specialized approaches due to the challenges of studying transmembrane protein complexes. Co-immunoprecipitation studies using mild detergents (such as Brij97 or CHAPS) that preserve tetraspanin-enriched microdomains are essential for identifying native interaction partners. For mapping specific interaction domains, researchers should generate deletion mutants of TSPAN10's structural elements (EC1, EC2, transmembrane domains, and cytoplasmic tails) and assess their binding capabilities. Proximity ligation assays (PLA) can visualize protein-protein interactions in situ with high specificity and sensitivity. For dynamic interaction studies, techniques like Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) allow real-time monitoring of TSPAN10's associations in living cells. To identify novel interaction partners, mass spectrometry analysis following immunoprecipitation has proven effective, as demonstrated by studies that identified TSPAN10's association with ADAM10. Crosslinking mass spectrometry can further pinpoint specific interaction residues. Finally, super-resolution microscopy techniques can reveal the spatial organization of TSPAN10 within tetraspanin-enriched microdomains and its colocalization with partner proteins .

What approaches can resolve contradictory findings regarding TSPAN10's role in different cellular contexts?

Resolving contradictory findings regarding TSPAN10's role across different cellular contexts requires systematic methodological approaches. First, researchers should conduct parallel studies in multiple cell types using identical experimental conditions and analytical methods to determine whether differences are truly context-dependent. Comprehensive characterization of TSPAN10 expression levels, post-translational modifications, and interaction partners across different cell types can identify factors that might explain context-specific functions. For contradictory findings regarding TSPAN10's effects on signaling pathways (such as Notch or ADAM10-mediated processes), time-course analyses can distinguish between immediate versus secondary effects and reveal whether temporal dynamics differ between cell types. Genetic rescue experiments introducing wild-type or mutant TSPAN10 into knockout backgrounds can test whether specific domains mediate context-dependent functions. Single-cell approaches, including single-cell RNA-seq or imaging, can reveal heterogeneity within cell populations that might explain seemingly contradictory results. Finally, systems biology approaches integrating transcriptomic, proteomic, and functional data can model how the same protein might produce different outcomes depending on the cellular network context .

How does TSPAN10 dysfunction contribute to retinal degenerative disorders beyond AMD?

While TSPAN10's role in Age-Related Macular Degeneration (AMD) has been established through genetic association studies, its dysfunction may contribute to other retinal degenerative disorders through several mechanisms. TSPAN10 knockouts show significantly reduced pigmentation and tyrosinase production in retinal pigment epithelium (RPE) cells, which could affect multiple RPE functions beyond those implicated in AMD. The compromised oxidative stress response in TSPAN10-deficient RPE cells, particularly the reduced expression of catalase, suggests a broader vulnerability to oxidative damage that could be relevant in various retinal conditions where oxidative stress is a pathogenic factor. Additionally, given TSPAN10's role in regulating ADAM10, which processes numerous substrates including those involved in retinal development and homeostasis, TSPAN10 dysfunction could potentially affect multiple signaling pathways relevant to retinal degenerative conditions. Research comparing TSPAN10 expression and function across different retinal disease models could reveal its contribution to disorders characterized by RPE dysfunction or oxidative damage, potentially including diabetic retinopathy, Stargardt disease, or retinitis pigmentosa .

What is the potential for targeting TSPAN10-ADAM10 interactions in therapeutic development?

The TSPAN10-ADAM10 regulatory axis presents a promising target for therapeutic development across multiple disease contexts. Since TSPAN10 specifically regulates ADAM10 maturation and activity, targeting this interaction could provide more selective modulation of ADAM10 function compared to direct ADAM10 inhibitors, potentially reducing off-target effects. In conditions where excessive ADAM10 activity contributes to pathology, disrupting the TSPAN10-ADAM10 interaction using small molecules or peptides that mimic interaction interfaces could reduce ADAM10 maturation and activity. Conversely, in contexts where enhanced ADAM10 function is desirable, stabilizing or enhancing TSPAN10-ADAM10 interactions could promote ADAM10 activity. The tissue-specific expression pattern of TSPAN10, particularly in ocular tissues, offers opportunities for targeted interventions in eye disorders like AMD with potentially fewer systemic effects. Development of therapeutic approaches would require detailed structural characterization of the TSPAN10-ADAM10 interaction, high-throughput screening for modulators, and careful evaluation of effects on specific ADAM10 substrates relevant to target diseases .

How can TSPAN10 knockout models advance our understanding of its role in developmental processes?

TSPAN10 knockout models provide powerful tools for elucidating its role in developmental processes across multiple tissues. In ocular development, complete or conditional TSPAN10 knockout models can reveal how TSPAN10-mediated regulation of RPE pigmentation, oxidative stress responses, and ADAM10 activity contributes to eye formation and function. The existing CRISPR/Cas9-generated TSPAN10 knockout in human embryonic stem cells that can be differentiated into RPE represents a valuable model for studying human-specific aspects of ocular development. For investigating TSPAN10's role in skeletal development, tissue-specific knockout models using osteoclast lineage-specific Cre drivers could assess how TSPAN10 deficiency affects bone formation and remodeling during different developmental stages. Since TSPAN10 regulates Notch signaling through ADAM10, developmental phenotypes should be carefully compared with those of Notch pathway mutants to determine which aspects of TSPAN10 knockout phenotypes are Notch-dependent. Single-cell transcriptomic analysis of developing tissues in wild-type versus knockout models could identify cell populations and developmental processes most affected by TSPAN10 deficiency, potentially revealing unexpected roles beyond currently known functions in RPE and osteoclasts .

What are the most promising future research directions for TSPAN10 biology?

Future TSPAN10 research should focus on several promising directions. First, comprehensive characterization of TSPAN10's interactome beyond ADAM10 could reveal additional partners and functions. Second, investigating tissue-specific roles of TSPAN10, particularly in contexts beyond the eye and bone where its functions remain largely unexplored, may uncover novel physiological roles. Third, detailed structural studies of TSPAN10-ADAM10 interactions would facilitate development of specific modulators with therapeutic potential. Fourth, exploring how TSPAN10 differentially regulates ADAM10 specificity toward various substrates could reveal mechanisms of proteolytic regulation. Fifth, investigating the role of TSPAN10 polymorphisms in disease susceptibility beyond AMD could identify new disease associations. Finally, developing tissue-specific knockout models will be essential for understanding TSPAN10's in vivo functions across different physiological and developmental contexts .

What technical innovations would advance TSPAN10 research methodology?

Several technical innovations would significantly advance TSPAN10 research. Development of highly specific antibodies against different epitopes of human and model organism TSPAN10 would improve detection of native protein in various contexts. Creation of fluorescent protein-tagged TSPAN10 constructs that maintain normal localization and function would enable live-cell imaging of TSPAN10 dynamics. Advanced structural biology approaches including cryo-electron microscopy of TSPAN10 in membrane environments could reveal its native conformation and interaction interfaces. Development of small molecule or peptide modulators specific to TSPAN10-ADAM10 interactions would provide valuable tools for functional studies. Single-molecule imaging techniques to visualize TSPAN10 organization within tetraspanin-enriched microdomains could reveal its membrane dynamics. Finally, organ-on-chip or organoid models incorporating TSPAN10 modifications would allow study of its function in physiologically relevant three-dimensional contexts that better recapitulate in vivo complexity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.