Recombinant Human Tetraspanin-12 (TSPAN12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage state, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSPAN12; NET2; TM4SF12; UNQ774/PRO1568; Tetraspanin-12; Tspan-12; Tetraspan NET-2; Transmembrane 4 superfamily member 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TSPAN12
Target Protein Sequence
MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYF PVVHPVMIAVCCFLIIVGMLGYCGTVKRNLLLLAWYFGSLLVIFCVELACGVWTYEQELM VPVQWSDMVTLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDS CCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQILAMIL TITLLWALYYDRREPGTDQMMSLKNDNSQHLSCPSVELLKPSLSRIFEHTSMANSFNTHF EMEEL
Uniprot No.

Target Background

Function
Tetraspanin-12 (TSPAN12) is a transmembrane protein that acts as a regulator of cell surface receptor signal transduction. It plays a crucial role in retinal vascularization by modulating norrin (NDP) signal transduction. TSPAN12 collaborates with norrin (NDP) to promote FZD4 multimerization, leading to FZD4 activation and subsequent accumulation of beta-catenin (CTNNB1), ultimately stimulating LEF/TCF-mediated transcriptional programs. Interestingly, TSPAN12 specifically activates the norrin (NDP)-dependent activation of FZD4, but not the Wnt-dependent activation, suggesting the presence of a Wnt-independent signaling pathway that also promotes beta-catenin (CTNNB1) accumulation. TSPAN12 acts as a regulator of membrane proteinases such as ADAM10 and MMP14/MT1-MMP. It activates ADAM10-dependent cleavage activity of amyloid precursor protein (APP) and MMP14/MT1-MMP-dependent cleavage activity.
Gene References Into Functions
  1. This study reports a group of patients with digenic familial exudative vitreoretinopathy (FEVR), showcasing a more severe phenotype than stage 3 in most affected eyes. We speculate that digenic FEVR-related gene variants may contribute to a more severe FEVR phenotype compared to monogenic variants. PMID: 30097784
  2. Targeted NGS identified two novel heterozygous deletion mutations [LRP5, c.4053 DelC (p.Ile1351IlefsX88); TSPAN12, EX8Del] as causative mutations for Familial exudative vitreoretinopathy (FEVR). PMID: 28867931
  3. Screening of candidate genes (NDP, FZD4, and TSPAN12) identified six major coding region variants in 36 ROP probands. PMID: 28982955
  4. The novel variant p.Cys189Arg in TSPAN12 was not observed in the affected 14-year-old daughter. Therefore, we conclude that the heterozygous FZD4 missense variant c.349T>C is likely a causative dominant mutation in this FEVR family. PMID: 28211206
  5. Probands with LRP5 or NDP mutations were predominantly categorized into groups III and IV, while TSPAN12 mutations were mainly observed in probands with groups IV and V FEVR. PMID: 29181528
  6. Among the detected mutations, LRP5 had the highest proportion with a mean mutation rate of 16.1% (5/31, 16.1%), followed by NDP (3/31, 9.7%), FZD4 (2/31, 6.5%), TSPAN12 (1/31, 3.2%), and KIF11 (1/31, 3.2%). All novel changes were predicted to be pathogenic based on bioinformatics analyses. PMID: 28494495
  7. Regarding FEVR-associated genes contributing to the disorder's autosomal dominant inheritance pattern in Korea, our findings indicate that patients with TSPAN12 large deletions were more prevalent than those with single nucleotide variants in TSPAN12. PMID: 28002565
  8. TSPAN12 promotes chemoresistance and proliferation of small cell lung carcinoma under the regulation of miR-495. PMID: 28302484
  9. Several novel mutations (missense, non-stop, and insertion) were detected in the coding regions of FZD4, TSPAN12, and ZNF408 genes among unrelated vitreoretinopathy probands. The mutations in FZD4 and TSPAN12 were involved in autosomal dominant and autosomal recessive families, further validating their role in familial exudative vitreoretinopathy development. PMID: 27316669
  10. This case report describes a female infant affected by cystic fibrosis and a severe form of exudative vitreoretinopathy, with the detection of the homozygous missense mutation c.668 T > C in TSPAN12. PMID: 23834558
  11. Novel mutations in TSPAN12 lead to autosomal recessive inheritance of congenital vitreoretinal disease with intra-familial phenotypic variability. PMID: 25250762
  12. Novel mutations have been identified in the TSPAN12 gene in Chinese patients with familial exudative vitreoretinopathy. PMID: 25352738
  13. These findings suggest that stroma-derived p53 plays a crucial role in epithelial cancer progression, and TSPAN12 and CXCL6 are potential targets for lung cancer therapy. PMID: 25512506
  14. TSPAN12 contributes to supporting primary tumor growth and suppressing metastasis. PMID: 23955570
  15. This study is the first to report recessive mutations in TSPAN12, demonstrating that patients with two mutant alleles exhibit a severe form of FEVR or retinal dysplasia, while heterozygous family members show milder familial exudative vitreoretinopathy phenotypes. PMID: 22427576
  16. The most pronounced miRNA-146a-TSPAN12 response to the stress of amyloidbeta peptide + tumor necrosis factoralpha is found in human neuronal glial cells from Alzheimer brain. PMID: 21640790
  17. We speculate that haploinsufficiency of TSPAN12 contributes to PHPV. PMID: 21626674
  18. TSPAN12 mutations are responsible for familial exudative vitreoretinopathy (FEVR). Phenotypes associated with TSPAN12 mutations demonstrate significant variations between individuals within a family and between the two eyes of individual patients. PMID: 21552475
  19. These results provide further evidence that mutations in TSPAN12 cause familial exudative vitreoretinopathy (FEVR) and that the gene products likely play a role in retinal vessel development. PMID: 21334594
  20. TSPAN12 promotes Norrin/Frizzled-4 signaling during retinal vascularization. PMID: 19837033
  21. Sequence analysis of TSPAN12 revealed two mutations segregating in five out of 11 familial exudative vitreoretinopathy families (FEVR), indicating that mutations in TSPAN12 are a relatively common cause of FEVR. PMID: 20159111
  22. Mutations in TSPAN12 also cause autosomal-dominant familial exudative vitreoretinopathy. PMID: 20159112
  23. TSPAN12 serves as a novel and robust partner for ADAM10 and promotes ADAM10 maturation, facilitating ADAM10-dependent proteolysis of APP. PMID: 19587294

Show More

Hide All

Database Links

HGNC: 21641

OMIM: 613138

KEGG: hsa:23554

STRING: 9606.ENSP00000222747

UniGene: Hs.16529

Involvement In Disease
Vitreoretinopathy, exudative 5 (EVR5)
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of human TSPAN12?

TSPAN12 belongs to the tetraspanin family, characterized by four transmembrane domains and two extracellular loops. The protein contains approximately 305 amino acids with a large extracellular loop (LEL) that mediates most protein-protein interactions. The LEL plays a critical role in TSPAN12's ability to regulate signaling pathways, particularly through its interaction with the Norrin-FZD4-LRP5 complex. TSPAN12 functions as a multi-pass membrane protein that creates specialized membrane microdomains through homo- and hetero-oligomerization with other membrane proteins .

What are the primary biological functions of TSPAN12?

TSPAN12 serves multiple functions in cellular physiology:

  • Plays a central role in retinal vascularization by regulating Norrin (NDP) signal transduction

  • Promotes FZD4 multimerization and subsequent activation, leading to β-catenin accumulation

  • Activates LEF/TCF-mediated transcriptional programs

  • Functions as a regulator of membrane proteinases including ADAM10 and MMP14/MT1-MMP

  • Contributes to blood-retina barrier (BRB) formation during development and maintenance in adults

  • Acts as a negative regulator of aldosterone production in adrenal cells

How does TSPAN12 contribute to retinal vascular development?

TSPAN12 functions in endothelial cells to promote vascular morphogenesis through its role in the Norrin signaling pathway. Research demonstrates that TSPAN12 specifically enhances Norrin-induced (but not Wnt-induced) β-catenin signaling by promoting FZD4 multimerization. In developing mice, endothelial cell-specific inactivation of TSPAN12 causes lack of intraretinal capillaries and increased VE-cadherin expression. These phenotypes recapitulate those observed in Ndp, Fzd4, and Lrp5 mutant mice, consistent with TSPAN12's role in the Norrin receptor complex .

What methodologies are most effective for studying TSPAN12's role in vascular development?

Effective methodologies include:

  • Conditional knockout models using tamoxifen-inducible Cdh5-CreERT2 drivers to recombine Tspan12 alleles specifically in endothelial cells

  • Confocal microscopy to document resulting phenotypes in the retinal vasculature

  • RNA-Seq analysis of retinal tissue to identify downstream effectors

  • Electroretinogram measurements to assess functional consequences

  • Histopathologic analysis to evaluate tissue architecture and integrity of the blood-retina barrier

  • In vitro co-culture systems to examine cell-autonomous and non-cell-autonomous effects

How does TSPAN12 influence cancer cell invasion and proliferation?

TSPAN12 has been identified as a critical factor for cancer-fibroblast cell contact-dependent signaling. In p53-depleted fibroblasts, TSPAN12 expression is derepressed and promotes cancer cell invasion and proliferation through direct cell-cell contact. Mechanistically, TSPAN12 regulates the β-catenin signaling pathway in fibroblasts, leading to increased expression and secretion of factors like CXCL6 that enhance cancer progression. Knockdown of TSPAN12 in p53-depleted fibroblasts inhibits cancer cell proliferation and invasion, while ectopic expression of TSPAN12 in normal fibroblasts increases these processes .

What experimental approaches can resolve contradictory findings about TSPAN12's role in different cancer types?

To address contradictory findings:

  • Compare TSPAN12 expression and function across diverse cancer types using tissue microarrays and patient-derived samples

  • Implement conditional TSPAN12 manipulation in both cancer cells and stromal cells simultaneously using CRISPR/Cas9 systems

  • Develop co-culture systems that model the tumor microenvironment, including cancer cells, fibroblasts, and endothelial cells

  • Use live-cell imaging to track TSPAN12-dependent cell-cell interactions in real-time

  • Apply single-cell RNA-Seq to distinguish cell type-specific responses to TSPAN12 modulation

  • Validate findings across multiple experimental models (2D culture, 3D spheroids, organoids, xenografts) to ensure robustness

How does TSPAN12 regulate aldosterone production in adrenal cells?

TSPAN12 functions as a negative regulator of aldosterone production. In aldosterone-producing adenomas (APAs), TSPAN12 expression levels are inversely correlated with baseline plasma aldosterone concentrations (R=-0.47; P=0.009). Mechanistically, TSPAN12 expression is increased by angiotensin II stimulation through a calcium-dependent pathway, as evidenced by the ablation of this effect by calcium channel blockers like nifedipine or calmodulin antagonists like W-7. Gene silencing of TSPAN12 in human adrenocortical cells increases aldosterone secretion under both basal and angiotensin II-stimulated conditions, confirming its negative regulatory role .

What research design would best elucidate the signaling pathway connecting TSPAN12 to aldosterone synthesis?

An optimal research design would include:

  • Phosphoproteomic analysis comparing control and TSPAN12-silenced adrenocortical cells to identify altered signaling pathways

  • ChIP-seq to determine if TSPAN12-regulated transcription factors bind to promoters of steroidogenic enzymes

  • Proximity labeling (BioID or APEX) to identify TSPAN12's protein interaction network in adrenocortical cells

  • Time-course experiments measuring calcium flux, cAMP levels, and protein kinase activation following angiotensin II stimulation in the presence or absence of TSPAN12

  • In vivo validation using adrenal-specific TSPAN12 knockout or overexpression models subjected to salt restriction or angiotensin II infusion

What are the most effective approaches for studying TSPAN12 trafficking and localization?

The most effective approaches include:

  • Endogenous tagging of TSPAN12 using CRISPR/Cas9 to avoid overexpression artifacts

  • Live-cell imaging with fluorescent protein fusions to track dynamic TSPAN12 movements

  • Super-resolution microscopy techniques (STED, PALM, STORM) to visualize TSPAN12-enriched microdomains

  • Co-localization studies with markers for different endosomal compartments (early, late, recycling endosomes)

  • Biotinylation assays to quantify surface versus intracellular TSPAN12 levels

  • Fluorescence recovery after photobleaching (FRAP) to measure TSPAN12 mobility within membranes

  • Proximity ligation assays to detect and quantify interactions with other membrane proteins in situ

How can researchers effectively express and purify recombinant TSPAN12 for structural studies?

For optimal expression and purification:

  • Express the protein in cell-free systems to avoid complications with membrane insertion

  • Alternatively, use specialized eukaryotic expression systems (insect cells, mammalian cells) that properly process transmembrane proteins

  • Include stabilizing fusion partners (MBP, SUMO) to enhance solubility

  • Employ gentle detergents (DDM, LMNG) for extraction while maintaining native conformation

  • Consider expressing only the large extracellular loop for binding studies if full-length protein proves challenging

  • Implement rigorous quality control including SEC-MALS to verify monodispersity and proper oligomeric state

  • Validate functionality of purified protein through binding assays with known partners (Norrin, FZD4)

How does TSPAN12 selectively enhance Norrin but not Wnt signaling through FZD4?

This selectivity arises from TSPAN12's distinct role in receptor complex assembly. Evidence suggests that TSPAN12 functions as a co-receptor specifically for Norrin, facilitating selective ligand recognition and enhancing Norrin/FZD4 signaling strength. TSPAN12 promotes FZD4 multimerization in response to Norrin but not Wnt ligands. FEVR-linked TSPAN12 mutations (including C105R, M210R, L223P, A237P, and L245P) strongly impair this activity, with some mutations (G188R, L201F) specifically affecting the rescue of signaling defects associated with Norrin mutations. This suggests that TSPAN12 creates specialized membrane microdomains that favor Norrin-specific signaling complexes over Wnt-induced ones .

What is the relationship between TSPAN12 and receptor recycling pathways in different cell types?

TSPAN12 plays crucial roles in receptor trafficking and recycling. In C. elegans, the TSPAN12 homologs TSP-12 and TSP-14 are localized on the cell surface and in various endosomal compartments (early, late, and recycling endosomes). They function redundantly to promote the recycling of BMP type II receptor DAF-4/BMPRII. Animals lacking both proteins show reduced cell-surface levels of DAF-4/BMPRII, impaired endosome morphology, and mislocalization of the receptor to late endosomes and lysosomes. This contrasts with the type I receptor SMA-6, which is recycled via the retromer complex, highlighting distinct recycling pathways for different receptor types. These findings suggest that mammalian TSPAN12 may similarly regulate receptor trafficking in various tissues, potentially explaining its diverse roles in retinal vascularization, cancer progression, and endocrine regulation .

What methodological approaches would best characterize TSPAN12's interaction partners across different cellular contexts?

Advanced methodological approaches include:

  • Proximity-dependent biotinylation (BioID or TurboID) with TSPAN12 as the bait in different cell types

  • Quantitative crosslinking mass spectrometry to identify direct binding partners

  • CRISPR screens to identify genes synthetic with TSPAN12 in different cellular processes

  • Single-molecule tracking to characterize the dynamics of TSPAN12-partner interactions

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Cryo-electron microscopy of TSPAN12-containing complexes to determine structural arrangements

  • Systems biology approaches integrating interactome, transcriptome, and functional data to build comprehensive models of TSPAN12 function

How can TSPAN12 animal models improve our understanding of familial exudative vitreoretinopathy (FEVR)?

TSPAN12 animal models provide valuable insights into FEVR pathophysiology:

  • Conditional knockout models allow temporal control over TSPAN12 inactivation, distinguishing developmental from maintenance roles

  • Introduction of specific FEVR-linked mutations (T49M, L101H, C105R, Y138C, G188R, L201F, M210R, L223P, A237P, L245P) in mouse Tspan12 can reveal phenotype-genotype correlations

  • Comparative analysis across models with mutations in other FEVR-associated genes (Ndp, Fzd4, Lrp5) helps elucidate common and distinct mechanisms

  • Cell type-specific deletion of TSPAN12 can determine the primary cellular sites of FEVR pathogenesis

  • Rescue experiments testing therapeutic approaches provide preclinical validation for potential treatments

What experimental design would best test the hypothesis that TSPAN12 dysfunction contributes to blood-brain barrier disorders beyond the retina?

A comprehensive experimental design would include:

  • Conditional deletion of TSPAN12 in brain endothelial cells using BBB-specific promoters

  • Assessment of BBB integrity using multiple complementary approaches:

    • Tracer injection studies with molecules of different sizes

    • Immunohistochemical analysis of tight junction proteins

    • Electron microscopy of brain endothelial junctions

    • In vivo imaging of barrier function

  • Transcriptomic and proteomic profiling of isolated brain vessels from control and TSPAN12-deficient mice

  • Functional assessment of BBB-dependent processes, including immune cell trafficking and drug penetration

  • Correlation of findings with human neurological conditions involving BBB dysfunction through analysis of genetic data and tissue samples

What bioinformatic approaches can identify potential TSPAN12-regulated genes across different biological contexts?

Robust bioinformatic approaches include:

  • Meta-analysis of transcriptomic datasets from TSPAN12 manipulation studies across cell types

  • Motif analysis of promoters/enhancers of differentially expressed genes to identify common transcription factor binding sites

  • Network analysis to identify hub genes and pathways consistently affected by TSPAN12 modulation

  • Integration of ChIP-seq data for β-catenin and LEF/TCF factors with TSPAN12-dependent gene expression changes

  • Single-cell RNA-seq analysis to delineate cell type-specific responses to TSPAN12 perturbation

  • Computational modeling of signaling network responses incorporating TSPAN12 as a modifier of receptor complex formation

  • Cross-species conservation analysis to identify evolutionarily preserved TSPAN12-dependent processes

How should researchers address data discrepancies between in vitro and in vivo TSPAN12 studies?

To reconcile discrepancies:

  • Perform systematic comparison of TSPAN12 expression levels between experimental systems and physiological tissues

  • Evaluate differences in microenvironmental factors present in vivo but absent in vitro

  • Implement more physiologically relevant in vitro systems (3D cultures, co-cultures, flow conditions)

  • Conduct parallel studies in multiple model systems with standardized endpoints and analysis methods

  • Apply systems biology approaches to identify context-dependent network states that influence TSPAN12 function

  • Design experiments that directly test whether specific factors account for observed discrepancies

  • Validate key findings using patient-derived samples whenever possible

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.