Recombinant Human Tetraspanin-14 (TSPAN14)

Shipped with Ice Packs
In Stock

Description

  • Repeated freeze-thaw cycles degrade protein integrity .

  • The LEL domain shares 98% amino acid identity across humans, mice, and rats, enabling cross-species studies .

Functional Roles

TSPAN14 regulates key cellular processes through interactions with ADAM10 and other partners:

Key Interactions:

  • ADAM10 Activation: TSPAN14 promotes ADAM10-mediated cleavage of cadherins (e.g., CDH5), influencing cell adhesion and signaling .

  • Matrix Degradation: Reduced TSPAN14 expression upregulates MMP-2/MMP-9, enhancing cancer cell invasion .

  • Immune Modulation: Tetraspanin microdomains facilitate MHC-II antigen presentation, linking TSPAN14 to T-cell activation .

Table 1: Key Studies Using Recombinant TSPAN14

ApplicationFindingsSource
Cancer Biomarker DevelopmentTSPAN14 is a prognostic marker in lung adenocarcinoma (LUAD); high expression correlates with poor survival .
ADAM10 RegulationTSPAN14 stabilizes ADAM10 on the cell surface, enhancing substrate cleavage .
Structural AnalysisCryo-EM studies using recombinant LEL reveal conformational changes during ligand binding .

Clinical and Mechanistic Insights

  • Cancer: In LUAD, TSPAN14 is part of a 5-gene prognostic model (TSPAN7, TSPAN11, TSPAN14, UPK1B, UPK1A) that predicts tumor immune infiltration and patient outcomes .

  • Therapeutic Targeting: TSPAN14-ADAM10 complexes are explored for modulating Notch signaling in breast cancer .

Challenges and Future Directions

  • Isoform Complexity: While human TSPAN14 isoforms remain uncharacterized, lessons from C. elegans suggest isoform-specific roles in trafficking and signaling .

  • Stability Issues: Recombinant TSPAN14 requires stringent storage conditions to maintain activity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSPAN14; TM4SF14; Tetraspanin-14; Tspan-14; DC-TM4F2; Transmembrane 4 superfamily member 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TSPAN14
Target Protein Sequence
MHYYRYSNAKVSCWYKYLLFSYNIIFWLAGVVFLGVGLWAWSEKGVLSDLTKVTRMHGID PVVLVLMVGVVMFTLGFAGCVGALRENICLLNFFCGTIVLIFFLELAVAVLAFLFQDWVR DRFREFFESNIKSYRDDIDLQNLIDSLQKANQCCGAYGPEDWDLNVYFNCSGASYSREKC GVPFSCCVPDPAQKVVNTQCGYDVRIQLKSKWDESIFTKGCIQALESWLPRNIYIVAGVF IAISLLQIFGIFLARTLISDIEAVKAGHHF
Uniprot No.

Target Background

Function
Tetraspanin-14 (TSPAN14) plays a regulatory role in the maturation and trafficking of the transmembrane metalloprotease ADAM10. It negatively regulates ADAM10-mediated cleavage of GP6 and promotes ADAM10-mediated cleavage of CDH5.
Gene References Into Functions
  1. Research suggests that the large extracellular loop of Tspan14 interacts with ADAM10, promoting ADAM10 maturation and trafficking to the cell surface, and influencing ADAM10 substrate specificity. This interaction between ADAM10 and Tspan14 occurs in platelets and vascular endothelial cells. PMID: 26668317
  2. Genetic alterations in TSPAN14, SLC2A13, and PHF20 may contribute to the development of non-small-cell lung cancer. PMID: 19473719
Database Links

HGNC: 23303

KEGG: hsa:81619

STRING: 9606.ENSP00000361229

UniGene: Hs.718943

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of TSPAN14?

TSPAN14 belongs to the TspanC8 subfamily of tetraspanins, characterized by four transmembrane domains that create a unique protein scaffold. Like other tetraspanins, TSPAN14 functions as an organizer of membrane microdomains, facilitating the assembly of tetraspanin-enriched microdomains (TEMs) that bring together various proteins for coordinated signaling and trafficking processes .

The protein's structure includes small and large extracellular loops, with the large extracellular loop mediating most protein-protein interactions. TSPAN14's functional importance is evident from studies showing it can regulate membrane protein trafficking and recycling pathways, similar to how TSP-12 and TSP-14 (C. elegans tetraspanins) regulate BMP receptor recycling . In humans, TSPAN14's expression pattern varies across tissues, with notable functions in cellular migration, invasion, and extracellular matrix remodeling processes .

How is TSPAN14 expression altered in cancer tissues?

TSPAN14 expression exhibits significant alterations in cancer tissues compared to normal counterparts, with particularly well-documented changes in non-small cell lung cancer (NSCLC). Studies have demonstrated that TSPAN14 expression is notably lower in NSCLC tumor cells compared to adjacent non-tumor cells . This decreased expression pattern correlates with poor survival outcomes in NSCLC patients.

Analysis of clinical samples has revealed important relationships between TSPAN14 expression and tumor characteristics, as shown in the following table adapted from patient data:

ParameterTotal NumberDecreased TSPAN14 Expressionp-Value
NSCLC subtype
Adenocarcinoma166 (37.5%)1
Squamous cell carcinoma248 (33.3%)
Histological grade
g194 (44.4%)0.79
g2269 (34.6%)
g351 (20.0%)

Notably, decreased TSPAN14 expression is most frequently observed in more aggressive, invasive tumor types, suggesting its potential role as a tumor suppressor in NSCLC progression .

What are the known isoforms of TSPAN14 and how do they differ?

Studies in model organisms, particularly C. elegans, have provided valuable insights into TSPAN14 isoforms that likely parallel human biology. The C. elegans TSPAN14 ortholog (tsp-14) encodes two major protein isoforms, TSP-14A and TSP-14B, which differ by only 24 amino acids at their N-termini .

These isoforms exhibit both unique and overlapping functions in developmental processes. Most notably, they show distinct subcellular localization patterns: TSP-14A predominantly localizes to apical intracellular vesicles, while TSP-14B localizes to the plasma membrane on the basolateral side . This differential localization is largely determined by a basolateral membrane localization signal within the 24 amino acids unique to the TSP-14B isoform .

Human TSPAN14 likely exhibits similar isoform diversity, contributing to its multifunctional nature across different cellular contexts. When working with recombinant TSPAN14, researchers should consider which isoform(s) to express based on their specific experimental objectives .

What are the primary subcellular localization patterns of TSPAN14?

TSPAN14's subcellular localization varies depending on cell type and isoform expression. Based on studies with tagged TSPAN14 proteins and their orthologs, several consistent patterns emerge. The protein can be found in multiple cellular compartments, including:

  • Plasma membrane - particularly at the basolateral surface for certain isoforms

  • Endosomal compartments - including early, late, and recycling endosomes

  • Intracellular vesicles - especially for the shorter isoform variants

Research in C. elegans has been particularly informative, showing that the TSP-14A isoform predominantly localizes to apical intracellular vesicles, while TSP-14B localizes to the basolateral plasma membrane . This differential localization is functionally significant, as it determines which protein partners TSPAN14 can interact with and which cellular processes it can regulate.

The localization patterns can be visualized and quantified using techniques such as immunofluorescence microscopy and flow cytometry. For instance, researchers have calculated corrected total cell fluorescence (CTCF) corresponding to tetraspanin signals using the formula: CTCF = Integrated density − (Area × Mean fluorescence of background readings) .

How does TSPAN14 contribute to cancer progression mechanisms?

TSPAN14 appears to function primarily as a tumor suppressor in non-small cell lung cancer (NSCLC), with its decreased expression correlating with enhanced cancer progression. Mechanistically, TSPAN14 regulates multiple aspects of tumor cell behavior:

First, TSPAN14 modulates the expression and activity of matrix metalloproteinases (MMPs), particularly MMP-2 and MMP-9. When TSPAN14 is silenced in non-metastatic cancer cells, there is a marked increase in MMP-2 and MMP-9 expression, leading to enhanced capacity of cancer cells to degrade extracellular matrix components . This directly impacts invasive potential, as MMPs facilitate the breakdown of tissue barriers that would otherwise contain the tumor.

Second, TSPAN14 influences cellular migration capabilities. The inverse relationship between TSPAN14 expression and metastatic potential has been demonstrated in NSCLC cell lines, where the highly invasive NCI-H661 line expresses minimal TSPAN14, while the non-metastatic NCI-H460 line exhibits high TSPAN14 levels .

Third, TSPAN14 may regulate receptor trafficking and recycling pathways, similar to how its ortholog in C. elegans (TSP-14) controls BMP receptor recycling . This suggests TSPAN14 could modulate growth factor signaling in cancer cells by affecting receptor availability at the cell surface.

What methodologies are most effective for studying TSPAN14 protein-protein interactions?

Studying TSPAN14 protein-protein interactions requires specialized approaches due to its transmembrane nature and involvement in multiprotein complexes. The following methodologies are particularly effective:

  • Co-immunoprecipitation (Co-IP) with mild detergents: When isolating TSPAN14 complexes, mild detergents like CHAPS or Brij-97 preserve tetraspanin-enriched microdomains (TEMs) better than stronger detergents like Triton X-100, which can disrupt these interactions.

  • Proximity labeling approaches: BioID or APEX2 fusion proteins can identify proteins in close proximity to TSPAN14 in living cells, capturing both stable and transient interactions that might be lost during traditional IP.

  • FRET (Fluorescence Resonance Energy Transfer) or BRET (Bioluminescence Resonance Energy Transfer): These techniques can detect direct protein-protein interactions in living cells, providing spatial and temporal information about TSPAN14 interactions.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry can capture direct binding partners and provide structural information about the interaction interfaces.

  • Yeast two-hybrid membrane protein systems: Modified yeast two-hybrid systems designed for membrane proteins can screen for direct TSPAN14 binding partners.

When analyzing interaction data, researchers should consider that TSPAN14, like other tetraspanins, may function through both direct protein binding and through organizing larger multiprotein complexes within tetraspanin-enriched microdomains .

How can researchers effectively generate and validate recombinant TSPAN14 for in vitro studies?

Generating functional recombinant TSPAN14 presents several challenges due to its transmembrane nature and potential post-translational modifications. The following protocol outlines an effective approach:

  • Expression system selection: Mammalian expression systems (HEK293, CHO cells) generally provide better folding and post-translational modifications than bacterial systems. Insect cell systems (Sf9, Hi5) represent a good middle ground for higher yield with proper folding.

  • Construct design considerations:

    • Include purification tags (His, FLAG, or Strep) preferably at the C-terminus to avoid interfering with N-terminal isoform differences

    • Consider including a cleavable signal peptide to enhance membrane insertion

    • For specific isoform studies, ensure proper inclusion of the N-terminal sequences that differentiate TSPAN14 variants

    • For soluble protein production, design constructs containing only the large extracellular loop

  • Purification strategy:

    • Use mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) for extraction

    • Employ affinity chromatography based on the chosen tag, followed by size exclusion chromatography

  • Validation methods:

    • Western blotting with TSPAN14-specific antibodies

    • Mass spectrometry to confirm protein identity and post-translational modifications

    • Circular dichroism to assess proper folding

    • Functional assays relevant to known TSPAN14 activities, such as interaction with known binding partners

For expression quantification, techniques like flow cytometry can be employed. The mean fluorescence intensity (MFI) can be measured after labeling with anti-TSPAN14 antibodies, with proper controls to account for background fluorescence .

What is the relationship between TSPAN14 and matrix metalloproteinases in cancer progression?

TSPAN14 exhibits a regulatory relationship with matrix metalloproteinases (MMPs), particularly MMP-2 and MMP-9, which significantly impacts cancer cell invasiveness and metastatic potential. Research has established several key aspects of this relationship:

First, TSPAN14 expression levels inversely correlate with MMP expression. Studies in NSCLC cell lines have shown that silencing TSPAN14 in non-metastatic cancer cells leads to increased expression of MMP-2 and MMP-9 at both mRNA and protein levels . This suggests TSPAN14 may function as a negative regulator of these matrix-degrading enzymes.

Second, the functional consequence of this regulation is directly observable in matrix degradation assays. NSCLC cells with reduced TSPAN14 expression demonstrate an elevated capacity to degrade gelatin, which serves as a substrate for MMPs . This enhanced degradative capacity translates to increased invasive potential.

Third, the molecular mechanism likely involves TSPAN14's role in organizing membrane microdomains that regulate MMP activation and/or trafficking. While MMP-14 (MT1-MMP) functions as a membrane-bound activator of other MMPs , TSPAN14 may influence its localization or activity through tetraspanin-enriched microdomains.

Methodologically, researchers can study this relationship through:

  • qRT-PCR analysis of MMP expression following TSPAN14 knockdown or overexpression

  • Gelatin zymography to assess MMP activity

  • In vitro invasion assays using Matrigel or collagen matrices

  • Co-localization studies of TSPAN14 with MMPs using high-resolution microscopy

How do TSPAN14 isoforms exhibit different localizations and functions in cellular models?

TSPAN14 isoforms demonstrate remarkable differences in both subcellular localization and function, providing insight into the protein's diverse biological roles. Based on studies primarily in C. elegans, we can extrapolate principles likely applicable to human TSPAN14:

The two major isoforms identified in C. elegans, TSP-14A and TSP-14B, differ by only 24 amino acids at their N-termini but exhibit distinct localization patterns. TSP-14A predominantly localizes to apical intracellular vesicles, while TSP-14B is found mainly at the basolateral plasma membrane . This differential localization appears to be directed by a specific basolateral membrane localization signal within the 24 amino acids unique to TSP-14B .

Functionally, these isoforms display both unique and overlapping roles:

  • In mesoderm development, TSP-14B plays a major role, while normal development requires both TSP-14A and TSP-14B along with TSP-12 .

  • For body size regulation, both isoforms can significantly rescue defects in tsp-12(0); tsp-14(0) double mutants, suggesting overlapping functions in this process .

  • The expression efficiency of each isoform also differs based on the promoter elements used, with the longer 5.2kb promoter driving more efficient expression than the 3.3kb promoter .

To study isoform-specific functions in mammalian systems, researchers should:

  • Create isoform-specific expression constructs with distinct tags

  • Use CRISPR/Cas9 to selectively modify individual isoforms

  • Employ super-resolution microscopy to precisely define subcellular localization

  • Conduct isoform-specific rescue experiments in knockout models

What techniques are recommended for analyzing TSPAN14's role in matrix degradation and metastatic potential?

To comprehensively analyze TSPAN14's impact on matrix degradation and metastatic potential, researchers should employ a combination of in vitro, ex vivo, and in vivo techniques:

  • In vitro matrix degradation assays:

    • Fluorescent gelatin degradation assay: Cells are plated on fluorescently labeled gelatin, and dark areas indicate degradation zones

    • Collagen contraction assay: Measures the ability of cells to remodel collagen matrices

    • Zymography: Detects MMP activity in conditioned media following TSPAN14 manipulation

  • Cell migration and invasion assays:

    • Transwell migration assays with or without Matrigel coating

    • Wound healing assays to assess collective cell migration

    • 3D spheroid invasion assays in extracellular matrix to better recapitulate the tumor microenvironment

  • Molecular analysis techniques:

    • qRT-PCR for quantifying MMP2 and MMP9 expression levels, using validated reference genes like HPRT1 or ACTB

    • Flow cytometry to measure TSPAN14 protein levels, calculating mean fluorescence intensity (MFI) with proper controls

    • Immunofluorescence microscopy with quantitative image analysis using corrected total cell fluorescence (CTCF)

  • In vivo metastasis models:

    • Orthotopic tumor implantation followed by metastasis quantification

    • Experimental metastasis assays via tail vein injection

    • Patient-derived xenograft models to assess clinical relevance

The NSCLC cell line panel offers a valuable model system, with the highly invasive NCI-H661 line showing minimal TSPAN14 expression and the non-metastatic NCI-H460 line exhibiting high TSPAN14 levels . This natural expression pattern provides an excellent platform for comparative studies and manipulation experiments.

How can CRISPR-Cas9 be utilized to study TSPAN14 function in cancer models?

CRISPR-Cas9 technology offers powerful approaches for investigating TSPAN14 function in cancer models, enabling precise genetic manipulation with several strategic applications:

  • Complete TSPAN14 knockout:

    • Design guide RNAs targeting early exons common to all isoforms

    • Verify knockout via Western blot, qRT-PCR, and genomic sequencing

    • Assess phenotypic changes in proliferation, migration, invasion, and matrix degradation

    • Examine effects on MMP expression and activity

  • Isoform-specific manipulation:

    • Target unique exons or splice junctions specific to individual TSPAN14 isoforms

    • Create isoform-specific knockouts to assess their distinct contributions

    • Design knock-in mutations in the basolateral localization signal to alter trafficking

  • Endogenous tagging:

    • Insert fluorescent protein tags (GFP, mCherry) at the C-terminus to track endogenous TSPAN14 localization

    • Add epitope tags (FLAG, HA) for improved immunoprecipitation of endogenous complexes

    • Create dual-tagged cell lines to simultaneously track multiple proteins

  • Domain-specific mutagenesis:

    • Introduce point mutations in key functional domains

    • Modify tetraspanin transmembrane domains to alter interaction with membrane partners

    • Create chimeric constructs swapping domains between different tetraspanins

  • Transcriptional modulation:

    • Use CRISPRa (activation) to upregulate TSPAN14 in low-expressing metastatic cell lines

    • Apply CRISPRi (interference) for partial repression without complete knockout

For validation of CRISPR modifications, researchers should employ a combination of genomic sequencing, Western blotting, qRT-PCR with primers specific to distinct regions (e.g., TSPAN14 Hs00229502_m1), and functional assays relevant to cancer progression .

What are the emerging areas of TSPAN14 research?

TSPAN14 research is expanding into several promising directions that merit further investigation. While current evidence establishes TSPAN14 as a potential tumor suppressor in NSCLC , several key questions remain unanswered and represent fertile ground for future research:

  • Tetraspanin-enriched microdomain (TEM) composition: Comprehensive proteomic analysis of TSPAN14-containing TEMs in different cell types would reveal context-specific interaction networks and signaling hubs.

  • Isoform-specific interactomes: Identifying differential binding partners of TSPAN14 isoforms would illuminate their distinct functional roles in normal and pathological contexts .

  • Therapeutic targeting strategies: Given TSPAN14's apparent tumor-suppressive role in NSCLC, approaches to selectively upregulate its expression or enhance its function in cancer cells could represent novel therapeutic avenues.

  • TSPAN14 in immune system regulation: Investigating whether TSPAN14, like other tetraspanins (CD9, CD81, CD37) , plays roles in immune cell function could uncover implications for cancer immunotherapy.

  • Cross-talk with other signaling pathways: Exploring TSPAN14's potential interactions with established cancer-related pathways beyond MMP regulation, such as growth factor signaling, Wnt pathway, or cell adhesion complexes.

  • Post-translational modifications: Characterizing how glycosylation, palmitoylation, and other modifications affect TSPAN14 function and interactions.

  • TSPAN14 in non-cancer diseases: Expanding research into potential roles in neurological disorders, given that mutations in other tetraspanins like Tspan7 are associated with X-linked mental retardation .

These emerging areas highlight the complex and multifaceted nature of TSPAN14 biology and its potential significance beyond currently established functions in cancer progression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.