Recombinant Human Tetraspanin-16 (TSPAN16)

Shipped with Ice Packs
In Stock

Description

Key Features of TSPAN16

PropertyDescriptionSource
Gene ID26526
UniProt EntryQ9UKR8
Molecular Weight22–39 kDa (typical for tetraspanins)
Expression RegionFull-length (1–245 amino acids)
Post-Translational ModificationsN-terminal ubiquitination sites (K8, K11, K17) observed in related tetraspanins

Production and Expression Systems

Recombinant TSPAN16 is synthesized using:

  • E. coli systems for bacterial expression, often with N-terminal His-tags for purification .

  • Lentiviral vectors (e.g., pLTC) for mammalian cell expression, enabling stable integration into host genomes .

Research Applications

TSPAN16 serves as a tool for studying:

Protein Interactions

  • Scaffolding roles: Organizes membrane microdomains (TEMs) with integrins, ADAM10, and other tetraspanins (e.g., CD81, CD9) .

  • Signaling regulation: Modulates pathways like PI3K/Akt, ERK, and Wnt/β-catenin, influencing cell proliferation and migration .

Disease Mechanisms

  • Neurological disorders: Linked to spastic paraplegia (OMIM 617580) and corpus callosum agenesis with peripheral neuropathy .

  • Cancer: While not directly studied in TSPAN16, tetraspanins like TSPAN1 and TSPAN15 are implicated in hepatocellular carcinoma (HCC) and pancreatic cancer (PC) via autophagy and integrin signaling .

Therapeutic Targeting

  • Antibody-based capture: Recombinant TSPAN16 fragments aid in developing antibodies for circulating tumor cell detection (e.g., mucin16, EpCAM) .

  • Gene therapy: siRNA targeting TSPAN16 homologs (e.g., TSPAN1) in HCC models improves survival, suggesting potential for TSPAN16-based therapies .

Disease Associations

TSPAN16 mutations are implicated in:

DiseaseOMIM EntryPathological RoleSource
Spastic Paraplegia 87617580Axonal degeneration in the spinal cord
Agenesis of Corpus CallosumN/ANeural migration defects

Comparative Analysis with Other Tetraspanins

TetraspaninKey FunctionDisease LinkSource
TSPAN16Neural and hematopoietic regulationSpastic paraplegia
TSPAN1Autophagy, PI3K/Akt signalingHCC, PC
CD81B cell signaling, MHC presentationAutoimmune diseases
CD9Integrin β1-dependent adhesionCRC progression

Challenges and Future Directions

  • Structural complexity: Limited high-resolution structures hinder drug design targeting TSPAN16 .

  • Tissue-specific roles: Further studies are needed to dissect TSPAN16’s functions in neural vs. hematopoietic contexts .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TSPAN16; TM4SF16; Tetraspanin-16; Tspan-16; Tetraspanin TM4-B; Transmembrane 4 superfamily member 16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TSPAN16
Target Protein Sequence
MAEIHTPYSSLKKLLSLLNGFVAVSGIILVGLGIGGKCGGASLTNVLGLSSAYLLHVGNL CLVMGCITVLLGCAGWYGATKESRGTLLFCILSMVIVLIMEVTAATVVLLFFPIVGDVAL EHTFVTLRKNYRGYNEPDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGHTYPRSCC KSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQSFTLSGSSLGAAVIQRWGSRYVAQAG LELLA
Uniprot No.

Target Background

Database Links

HGNC: 30725

OMIM: 617580

KEGG: hsa:26526

STRING: 9606.ENSP00000319486

UniGene: Hs.579784

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Broadly expressed in most human tissues and cell lines including neural and bone marrow derived tissues.

Q&A

What is the structural characterization of human TSPAN16?

Human Tetraspanin-16 belongs to the tetraspanin superfamily of membrane proteins that span the membrane four times. Like other tetraspanins, TSPAN16 likely consists of four transmembrane domains, two extracellular loops (EC1 and EC2), and short intracellular N- and C-terminal tails . The EC2 domain is particularly important as it confers specificity to individual tetraspanin members and is involved in most protein-protein interactions. Structural analysis of other tetraspanins has shown that EC2 domains typically contain approximately 50% α-helical content, as demonstrated for CD9 and CD81 EC2 domains . To characterize TSPAN16's structure, researchers typically employ circular dichroism (CD) spectroscopy, X-ray crystallography, or cryo-electron microscopy depending on the specific structural elements being investigated.

How does recombinant TSPAN16 differ from native TSPAN16?

Recombinant TSPAN16 is produced through genetic engineering by inserting the TSPAN16 gene into a host organism for expression, whereas native TSPAN16 is naturally expressed in human cells . Key differences include:

  • Post-translational modifications: Recombinant proteins may lack proper glycosylation patterns or other modifications depending on the expression system used (bacterial, mammalian, insect, or yeast cells) .

  • Protein tags: Recombinant TSPAN16 is often produced with fusion tags such as His-tag or rho-1D4 tag to facilitate purification and detection .

  • Folding quality: Expression systems affect protein folding; mammalian systems generally produce better-folded tetraspanin proteins compared to bacterial systems, which may have inferior folding and potential LPS contamination .

  • Functional domains: Recombinant TSPAN16 often consists of specific domains (particularly the EC2 domain) rather than the full-length protein, which affects functional properties .

What expression systems are commonly used for producing recombinant TSPAN16?

Multiple expression systems can be employed for TSPAN16 production, each with distinct advantages:

Expression SystemAdvantagesLimitationsApplications
Bacterial (E. coli)High yield, cost-effective, rapid productionLimited post-translational modifications, potential LPS contamination, inferior foldingEC2 domain studies, antibody production
Mammalian (HEK293, CHO)Proper folding, post-translational modifications, native-like structureLower yield, higher cost, longer production timeFunctional studies, structural analysis
Insect (Sf9, Hi5)Higher yield than mammalian, some post-translational modificationsMore costly than bacterial, different glycosylation patternsStructural studies, protein-protein interactions
Yeast (P. pastoris)High yield, some post-translational modificationsHyperglycosylation, different glycosylation patternLarge-scale production of EC2 domains

Bacterial expression systems have been successfully used for producing tetraspanin EC2 domains, although challenges with protein folding have been noted . For full structural and functional studies, mammalian expression systems may be preferred despite difficulties reported in some expression attempts .

What are the optimal conditions for expressing and purifying recombinant TSPAN16?

For successful expression and purification of recombinant TSPAN16, researchers should consider:

Expression optimization:

  • Bacterial expression: Use BL21(DE3) or Rosetta strains with induction at OD600 of 0.6-0.8 using 0.1-1.0 mM IPTG at 16-25°C for 16-20 hours to reduce inclusion body formation .

  • Mammalian expression: Transfect HEK293T cells using lipid-based transfection reagents or calcium phosphate methods with expression for 48-72 hours in serum-free media for cleaner purification .

Purification strategy:

  • For His-tagged TSPAN16: Use immobilized metal affinity chromatography (IMAC) with nickel or cobalt resins, followed by size exclusion chromatography .

  • For GST-fusion proteins: Utilize glutathione-agarose columns with careful optimization of tag removal using thrombin or PreScission protease .

  • Buffer conditions: Include 0.03-0.1% mild detergents (DDM, CHAPS) for full-length protein or PBS with reducing agents for EC2 domains .

Purification success should be verified through SDS-PAGE, Western blotting, and mass spectrometry to confirm protein identity and purity.

How can researchers validate the functional integrity of purified recombinant TSPAN16?

Several complementary approaches can verify TSPAN16 functional integrity:

  • Structural validation:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content (expected α-helical content approximately 50-52% for EC2 domains based on other tetraspanins)

    • Thermal shift assays to evaluate protein stability and proper folding

  • Functional assays:

    • Protein-protein interaction studies using pull-down assays, co-immunoprecipitation, or surface plasmon resonance

    • Cell-based functional assays examining effects on adhesion, migration, or fusion processes

    • Evaluation of binding to known tetraspanin partners using ELISA or biolayer interferometry

  • Quality control markers:

    • Monodispersity analysis using dynamic light scattering

    • Endotoxin testing, particularly for bacterially expressed proteins

    • Confirmation of expected post-translational modifications by mass spectrometry

Each validation method provides complementary information about protein quality and function.

How can TSPAN16 be incorporated into tetraspanin enriched microdomain (TEM) studies?

Investigating TSPAN16 in the context of tetraspanin enriched microdomains requires sophisticated approaches:

  • Membrane reconstitution systems:

    • Incorporate purified recombinant TSPAN16 into liposomes or nanodiscs along with potential partner proteins

    • Monitor microdomain formation using FRET or super-resolution microscopy

    • Compare TSPAN16-containing microdomains with those formed by other tetraspanins (CD9, CD63, CD81, CD151)

  • Live-cell imaging approaches:

    • Express fluorescently tagged TSPAN16 in cell lines

    • Use single-particle tracking or FRAP (Fluorescence Recovery After Photobleaching) to analyze dynamics within TEMs

    • Apply proximity ligation assays to detect TSPAN16 associations with partner proteins in situ

  • Proteomics analysis:

    • Use chemical crosslinking followed by mass spectrometry to identify TSPAN16 interaction partners

    • Compare TSPAN16-associated protein complexes under different cellular conditions

    • Apply quantitative proteomics to measure changes in TEM composition upon TSPAN16 manipulation

These approaches collectively provide insights into how TSPAN16 contributes to tetraspanin web functionality, which underlies its biological roles in bringing together proteins to form functional clusters .

What role might TSPAN16 play in immune regulation compared to other tetraspanins?

While specific roles of TSPAN16 in immune regulation are not directly mentioned in the search results, comparison with other tetraspanin functions suggests potential mechanisms:

  • Receptor clustering and signaling:

    • TSPAN16 may organize immune receptors similar to how other tetraspanins modulate IgE-mediated degranulation

    • Experimental approach: Test recombinant TSPAN16 EC2 domains in RBL-2H3 cell degranulation assays, comparing effects with CD9, CD63, CD81, and CD151 EC2 domains

  • Immune cell trafficking and adhesion:

    • TSPAN16 might regulate leukocyte migration through interactions with integrins or adhesion molecules

    • Methodology: Examine effects of recombinant TSPAN16 on immune cell adhesion, migration, and transmigration in transwell or 3D matrix systems

  • Antigen presentation:

    • Potential roles in MHC protein clustering and immunological synapse formation

    • Experimental design: Investigate TSPAN16 localization during antigen presentation using high-resolution imaging and functional consequences of TSPAN16 knockdown/overexpression

  • Tumor immunology applications:

    • Based on other tetraspanins' roles in cancer immunity, TSPAN16 may have prognostic value in tumors

    • Research approach: Analyze TSPAN16 expression patterns in tumor tissues and correlate with immune infiltration markers, similar to how other tetraspanin-related genes have been used in cancer prognosis models

How can researchers design experiments to resolve contradictory findings about TSPAN16 function?

When faced with contradictory data on TSPAN16 function, researchers should implement the following experimental design strategies:

  • Systematic validation across multiple systems:

    • Compare TSPAN16 functions across different cell types and species

    • Use both recombinant protein addition and genetic manipulation approaches (CRISPR/Cas9, siRNA, overexpression)

    • Verify antibody specificity using knockout controls and multiple detection methods

  • Control for technical variables:

    • Assess effects of different protein tags on TSPAN16 function

    • Test both full-length TSPAN16 and isolated domains (particularly EC2)

    • Control for potential contamination (e.g., LPS in bacterial preparations) that may confound results

  • Context-dependent function analysis:

    • Examine TSPAN16 function under different activation states

    • Test TSPAN16 in both isolated systems and complex environments

    • Consider temporal dynamics of TSPAN16 involvement in cellular processes

  • Reproducibility framework:

    • Implement blinded experimental design

    • Use multiple orthogonal techniques to address the same question

    • Apply appropriate statistical analyses with consideration of biological vs. technical replicates

A comprehensive multi-system approach helps resolve contradictions by identifying context-specific functions and technical artifacts.

How does TSPAN16 differ structurally and functionally from other tetraspanin family members?

Tetraspanin-16 can be distinguished from other family members through several key characteristics:

  • Structural comparison:

    • While all tetraspanins share the four-transmembrane domain architecture, TSPAN16's EC2 domain likely contains unique structural elements that differ from the better-characterized CD9, CD63, CD81, and CD151

    • Conserved cysteine patterns in EC2 domains are critical for proper disulfide bonding and folding; analysis of these patterns can reveal TSPAN16's subfamilial classification

  • Functional distinctions:

    • Unlike CD63, TSPAN16 likely lacks the lysosomal targeting motif (GYEVM) in its C-terminal region

    • TSPAN16 may have distinct partner preferences compared to CD9, CD81, and CD151, which are known to associate with specific integrins and signaling molecules

  • Expression pattern differences:

    • TSPAN16 exhibits tissue-specific expression that differs from ubiquitously expressed tetraspanins like CD81

    • This restricted expression pattern may indicate specialized functions in particular tissues

  • Evolutionary conservation:

    • Comparative sequence analysis across species can reveal TSPAN16-specific conserved motifs distinct from other tetraspanins

    • These uniquely conserved regions often correlate with specialized functions

Understanding these differences is critical for targeting TSPAN16-specific functions without affecting other tetraspanin family members.

What bioinformatics approaches can identify potential functional partners of TSPAN16?

Several computational strategies can predict TSPAN16 interaction partners:

  • Protein-protein interaction prediction:

    • Apply machine learning algorithms trained on known tetraspanin interactions

    • Use structural docking simulations focusing on the EC2 domain of TSPAN16

    • Analyze conservation patterns to identify potential interaction interfaces

  • Co-expression network analysis:

    • Mine RNA-seq databases to identify genes consistently co-expressed with TSPAN16

    • Apply weighted gene correlation network analysis (WGCNA) to identify functional modules containing TSPAN16

    • Use these networks to predict cellular pathways involving TSPAN16

  • Domain-based approaches:

    • Identify proteins containing domains known to interact with tetraspanin EC2 regions

    • Apply motif-based searches for proteins containing sequences complementary to TSPAN16-specific regions

  • Integration with experimental data:

    • Combine computational predictions with proteomics datasets

    • Filter predictions based on subcellular co-localization

    • Validate top candidates experimentally using co-immunoprecipitation or proximity labeling techniques

These bioinformatics approaches provide testable hypotheses about TSPAN16 functional partners that can guide experimental design.

What are common pitfalls in recombinant TSPAN16 research and how can they be addressed?

Researchers should be aware of these common challenges and their solutions:

  • Expression and purification issues:

    • Problem: Poor expression yields

    • Solution: Optimize codon usage for expression system, test different promoters, and expression conditions

    • Problem: Protein aggregation

    • Solution: Express at lower temperatures (16-20°C), include solubility enhancers like sorbitol or arginine, and optimize detergent selection for membrane protein extraction

  • Functional assessment challenges:

    • Problem: Distinguishing specific from non-specific effects

    • Solution: Include appropriate controls (other tetraspanin EC2 domains, denatured protein, tag-only controls)

    • Problem: LPS contamination in bacterial preparations

    • Solution: Include endotoxin removal steps, verify endotoxin levels, and include polymyxin B controls in functional assays

  • Antibody-related issues:

    • Problem: Limited availability of specific anti-TSPAN16 antibodies

    • Solution: Validate commercial antibodies thoroughly, consider generating new antibodies using recombinant TSPAN16 as immunogen, or use epitope tagging strategies

  • Reproducibility concerns:

    • Problem: Batch-to-batch variation

    • Solution: Implement rigorous quality control measures, maintain detailed documentation of production methods, and establish minimum acceptance criteria for each protein batch

Addressing these challenges systematically improves research reliability and facilitates cross-laboratory reproducibility.

How can researchers effectively study TSPAN16 in the context of tetraspanin-enriched microdomains (TEMs)?

Investigating TSPAN16 within TEMs requires specialized methodologies:

  • Membrane isolation and analysis:

    • Use detergent resistance analysis with mild detergents (CHAPS, Brij series) to preserve tetraspanin-tetraspanin interactions

    • Apply sucrose gradient ultracentrifugation to separate TEM fractions

    • Analyze TSPAN16 distribution across fractions by immunoblotting

    • Compare TSPAN16-containing TEMs with those containing other tetraspanins like CD9, CD63, CD81, and CD151

  • Advanced imaging techniques:

    • Implement super-resolution microscopy (STORM, PALM) to visualize TEM organization below the diffraction limit

    • Use multi-color imaging to assess co-localization between TSPAN16 and potential partners

    • Apply FRET or BRET to measure protein proximities within TEMs

    • Consider lattice light-sheet microscopy for dynamic studies of TEM formation and reorganization

  • Functional disruption strategies:

    • Apply EC2 domains as competitive inhibitors of tetraspanin interactions

    • Use CD spectroscopy to confirm proper folding of recombinant EC2 domains before functional studies

    • Design specific mutations in TSPAN16 to disrupt TEM formation without affecting protein expression

    • Compare phenotypic effects of TSPAN16 perturbation with disruption of other tetraspanins

These approaches collectively provide insights into TSPAN16's specific contributions to TEM organization and function.

How might TSPAN16 be involved in disease mechanisms based on known tetraspanin functions?

Building on known tetraspanin roles, TSPAN16 may contribute to disease through several mechanisms:

  • Cancer biology:

    • Potential involvement in tumor progression by modulating tumor immunity, similar to other tetraspanin-related genes that have demonstrated prognostic value in lung adenocarcinoma

    • Possible roles in metastasis through regulation of cell adhesion, migration, and invasion

    • Research direction: Analyze TSPAN16 expression patterns across cancer types and correlate with clinical outcomes and immune infiltration profiles

  • Immunological disorders:

    • Potential involvement in allergic responses through regulation of IgE-mediated degranulation, similar to CD9, CD63, CD81, and CD151

    • Possible contributions to inflammatory processes through modulation of leukocyte migration

    • Experimental approach: Examine TSPAN16 expression and function in relevant immune cell populations from patients with autoimmune or inflammatory conditions

  • Neurological conditions:

    • Tetraspanins regulate neuronal development and function; TSPAN16 might have specialized roles

    • Research strategy: Investigate TSPAN16 expression in neuronal tissues and potential contributions to neuronal signaling, synapse formation, or myelination

  • Infectious diseases:

    • Tetraspanins can serve as co-receptors for pathogens; TSPAN16 might play similar roles

    • Research approach: Screen for pathogen interactions with recombinant TSPAN16 and assess effects of TSPAN16 manipulation on infection models

These hypotheses can guide targeted investigations into TSPAN16's pathophysiological relevance.

What emerging technologies might advance our understanding of TSPAN16 biology?

Several cutting-edge approaches hold promise for TSPAN16 research:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for visualization of TSPAN16 in membrane contexts

    • Single-particle analysis to resolve conformational states

    • Integrative structural biology combining multiple data types (NMR, X-ray, molecular dynamics)

  • Genome editing and screening approaches:

    • CRISPR-Cas9 screens to identify genetic interactions with TSPAN16

    • Base editing to introduce specific TSPAN16 mutations without disrupting expression

    • Prime editing for precise modification of TSPAN16 regulatory elements

  • Single-cell technologies:

    • Single-cell proteomics to profile TSPAN16 expression at the protein level across cell types

    • Single-cell interactomics to map TSPAN16 protein interactions in individual cells

    • Spatial transcriptomics to visualize TSPAN16 expression patterns in tissue contexts

  • Microfluidic and organoid systems:

    • Organ-on-chip models incorporating TSPAN16-manipulated cells

    • Patient-derived organoids to study TSPAN16 function in disease-relevant contexts

    • Microfluidic co-culture systems to assess TSPAN16's role in cell-cell communication

These technologies will enable more precise and physiologically relevant investigations of TSPAN16 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.