Recombinant Human Tetraspanin-17 (TSPAN17)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Tetraspanin-17 (TSPAN17)

Recombinant Human Tetraspanin-17 (TSPAN17), a member of the tetraspanin family (TM4SF), is a transmembrane protein characterized by four hydrophobic domains and a large extracellular loop (LEL). Its primary role involves regulating the maturation, trafficking, and substrate specificity of the metalloprotease ADAM10 . Recombinant TSPAN17 is produced in heterologous systems (e.g., E. coli, yeast, or mammalian cells) for research applications, including functional studies in cancer biology, neurodegeneration, and immune regulation .

Role in Cancer

TSPAN17 is implicated in glioblastoma multiforme (GBM) progression. Key findings include:

  • miR-378a-3p Targeting: miR-378a-3p directly inhibits TSPAN17 expression, suppressing GBM cell proliferation, migration, and invasion .

  • ADAM10 Regulation: TSPAN17 promotes ADAM10 maturation and trafficking, influencing cleavage of substrates like Notch and VE-cadherin .

  • Prognostic Marker: High TSPAN17 expression correlates with poor survival in GBM patients aged 50–60 .

Neurological and Immunological Roles

  • Autism Spectrum Disorders (ASD): De novo nonsense mutations in TSPAN17 have been linked to ASD, suggesting a role in neurodevelopment .

  • Leukocyte Transmigration: TSPAN17 regulates ADAM10-dependent VE-cadherin shedding in endothelial cells, facilitating T-lymphocyte migration .

Mechanism of Action

TSPAN17 modulates ADAM10 through:

  1. ER-to-Cell Surface Trafficking: Ensures ADAM10 escapes the endoplasmic reticulum and matures .

  2. Substrate Specificity: Directs ADAM10 to cleave specific substrates (e.g., VE-cadherin vs. Notch) based on its localization .

  3. Conformational Regulation: May induce structural changes in ADAM10 to optimize catalytic activity .

Therapeutic and Diagnostic Potential

  • miRNA-Based Therapy: miR-378a-3p mimics could suppress TSPAN17 in GBM, offering a novel therapeutic avenue .

  • ADAM10 Inhibition: Targeting TSPAN17-ADAM10 complexes may reduce cancer metastasis or neuroinflammation .

Production and Handling Guidelines

ParameterRecommendation
Storage-20°C or -80°C (long-term); 4°C for short-term use
ReconstitutionAvoid repeated freeze-thaw cycles; use sterile buffers
StabilityLyophilized or liquid formats; ensure low endotoxin levels

References and Data Sources

  1. Structural Insights: Tetraspanins form mushroom-shaped LEL domains that bind cholesterol and interact with partner proteins .

  2. Cancer Studies: TSPAN17 knockdown reduces GBM cell migration, while overexpression rescues miR-378a-3p effects .

  3. ADAM10 Mechanism: TSPAN17 and Tspan5 redundantly maintain ADAM10-dependent VE-cadherin shedding in endothelial cells .

  4. Neurological Links: TSPAN17 mutations in ASD cohorts highlight its role in brain development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TSPAN17; FBXO23; TM4SF17; Tetraspanin-17; Tspan-17; F-box only protein 23; Tetraspan protein SB134; Transmembrane 4 superfamily member 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TSPAN17
Target Protein Sequence
MPGKHQHFQEPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISALTDLGG LDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDW IRDQLNLFINNNVKAYRDDIDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRE RCGVPFSCCVRDPAEDVLNTQCGYDVRLKLELEQQGFIHTKGCVGQFEKWLQDNLIVVAG VFMGIALLQIFGICLAQNLVSDIKAVKANW
Uniprot No.

Target Background

Function
Regulates ADAM10 maturation.
Database Links

HGNC: 13594

KEGG: hsa:26262

STRING: 9606.ENSP00000309036

UniGene: Hs.532129

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic molecular structure of Tetraspanin-17?

Tetraspanin-17 (TSPAN17) is a multi-pass membrane protein that belongs to the transmembrane 4 superfamily, also known as the tetraspanin family. It is characterized by four tetraspanin transmembrane segments that form a distinct structural motif. TSPAN17 is encoded by a gene located on chromosome 5q35.2 in humans, consisting of 9 exons . The protein contains critical domains that facilitate its membrane integration and interaction with other proteins within the tetraspanin web complex.

The protein structure includes:

  • Four transmembrane domains

  • Two extracellular loops (with the second loop being larger)

  • Short intracellular N and C termini

  • Conserved cysteine residues in the second extracellular domain that form disulfide bonds

What are the primary cellular functions of TSPAN17?

TSPAN17 appears to mediate signal transduction events that play roles in the regulation of cell development, activation, growth, and motility . Current research indicates that TSPAN17 is involved in:

  • Regulation of ADAM10 (A Disintegrin And Metalloproteinase 10) trafficking and maturation

  • Positive regulation of Notch signaling pathways

  • Cell surface receptor-linked signal transduction

  • Protein maturation processes

Additionally, TSPAN17 has been implicated in endothelial cell function, where TSPAN17-ADAM10 complexes may help regulate inflammation by maintaining normal VE-cadherin expression and promoting T lymphocyte transmigration .

What is the tissue distribution pattern of TSPAN17?

TSPAN17 shows low tissue specificity, meaning it is expressed across multiple tissue types rather than being confined to specific tissues . This broad expression pattern suggests that TSPAN17 may have diverse functions depending on the cellular context and interacting proteins in different tissues.

What are the most effective methods for measuring TSPAN17 expression in tissue samples?

Based on current research methodologies, TSPAN17 expression can be effectively measured using:

  • RT-qPCR for mRNA quantification:

    • Primer design is critical for specificity. A validated primer set for TSPAN17 includes:
      Forward: 5′-CACCAGCATTTCCAGGAACC-3′
      Reverse: 5′-CGCCTCCAACTACCACAAAC-3′

    • Use GAPDH as an internal control with primers:
      Forward: 5′-CGAGATCCCTCCAAAATCAA-3′
      Reverse: 5′-TTCACACCCATGACGAACAT-3′

    • Recommended thermocycling conditions: 95°C for 3 min; followed by 39 cycles of 95°C for 10 sec, 57°C for 15 sec, and 72°C for 30 sec; followed by 95°C for 10 sec, 65°C for 5 sec, and a final 95°C for 10 sec

    • Calculate relative expression using the 2−ΔΔCq method

  • Western blotting for protein quantification:

    • Use appropriate antibodies specific to human TSPAN17

    • Include proper loading controls

    • For quantification, normalize band intensity to the loading control

  • Immunohistochemistry for tissue localization:

    • Use paraffin-embedded or frozen sections

    • Apply appropriate antigen retrieval methods

    • Include positive and negative controls

What are the recommended protocols for siRNA-mediated knockdown of TSPAN17?

For effective TSPAN17 knockdown in experimental settings:

  • siRNA delivery methods:

    • Lentiviral vector-based transduction for stable knockdown

    • Lipid-based transfection for transient knockdown

  • Validation of knockdown efficiency:

    • Measure both mRNA levels via RT-qPCR and protein levels via Western blotting

    • Research has demonstrated significant reduction in TSPAN17 expression using siRNA:

      • mRNA levels reduced to approximately 0.11±0.001 (vs. si-NC control) in U87MG cells

      • Protein levels reduced to approximately 0.08±0.009 (vs. si-NC control) in U87MG cells

  • Controls:

    • Include scrambled siRNA negative control (si-NC)

    • Consider rescue experiments by re-expressing siRNA-resistant TSPAN17

What cellular assays are most informative for studying TSPAN17 function?

Based on current research approaches, the following assays have proven informative:

  • Cell proliferation assays:

    • MTT assays to measure metabolic activity

    • BrdU incorporation to measure DNA synthesis

    • Colony formation assays for long-term proliferation effects

  • Cell migration and invasion assays:

    • Transwell migration assays with or without Matrigel

    • Wound healing/scratch assays

    • Time-lapse microscopy for dynamic cell movement analysis

    • Recommended cell density: 1×10^5 cells in serum-free medium placed into the upper chamber of a Transwell insert

    • For visualization: stain with 0.1% crystal violet for 20 min and fix with 20% methanol at room temperature for 30 sec

  • Apoptosis assays:

    • Flow cytometry with Annexin V/PI staining

    • TUNEL assays for DNA fragmentation

    • Caspase activity assays

What is the role of TSPAN17 in glioblastoma multiforme (GBM)?

TSPAN17 has been significantly implicated in glioblastoma multiforme pathology:

How does TSPAN17 function in neurodegenerative disease models?

Studies in C. elegans have revealed important neuroprotective functions of TSP-17, the ortholog of human TSPAN17:

  • Protection against neurodegeneration:

    • TSP-17 protects dopaminergic neurons from 6-hydroxydopamine (6-OHDA)-induced degeneration

    • 6-OHDA is a neurotoxin used to model aspects of Parkinson's disease

    • Loss of TSP-17 function increases susceptibility to neurodegeneration

  • Mechanism of neuroprotection:

    • Genetic and pharmacological evidence suggests TSP-17 inhibits the dopamine transporter (DAT-1)

    • This inhibition prevents excessive uptake of neurotoxins like 6-OHDA

    • TSP-17 also protects against toxicity from excessive intracellular dopamine

  • Dopamine signaling modulation:

    • TSP-17 may act through the DOP-2 dopamine receptor to negatively regulate DAT-1

    • TSP-17 mutants show behavioral phenotypes linked to aberrant dopamine signaling

    • These include swimming-induced paralysis that varies by developmental stage

These findings suggest potential relevance of human TSPAN17 in neurological disorders, particularly those involving dopaminergic neurons like Parkinson's disease.

How does TSPAN17 interact with ADAM10, and what are the functional consequences?

TSPAN17 has been identified as a regulator of ADAM10 (A Disintegrin And Metalloproteinase 10):

  • Regulation of ADAM10 maturation:

    • TSPAN17 regulates the maturation process of ADAM10

    • This interaction appears to be part of a specific functional complex

  • Tetraspanin web involvement:

    • TSPAN17 likely incorporates ADAM10 into tetraspanin-enriched microdomains (TEMs)

    • These microdomains serve as organization centers for multiprotein complexes at the cell surface

    • The interaction may influence ADAM10 substrate specificity and activity

  • Endothelial function:

    • TSPAN17-ADAM10 complexes in endothelial cells may regulate inflammation

    • This occurs by maintaining normal VE-cadherin expression

    • The complexes may also promote T lymphocyte transmigration

  • Potential therapeutic implications:

    • Modulating TSPAN17-ADAM10 interactions could provide new therapeutic approaches

    • This might be particularly relevant in conditions where ADAM10 activity needs regulation

What is the relationship between miR-378a-3p and TSPAN17 in cancer biology?

Research has established a significant regulatory relationship between miR-378a-3p and TSPAN17 in cancer:

  • Direct targeting:

    • TSPAN17 has been identified and confirmed as a direct target of miR-378a-3p through luciferase reporter assays

    • miR-378a-3p negatively regulates TSPAN17 expression

  • Expression correlation:

    • Decreased miR-378a-3p expression is inversely correlated with TSPAN17 expression in GBM patients (r=-0.901, P<0.05)

    • This suggests a regulatory relationship in vivo

  • Functional antagonism:

    • Overexpression of miR-378a-3p in GBM cells inhibits TSPAN17 expression, induces apoptosis, and suppresses proliferation, migration, and invasion

    • Conversely, inhibition of miR-378a-3p using antagomirs increases TSPAN17 expression and promotes cellular growth and survival

    • TSPAN17 knockdown can partially reverse the effects of miR-378a-3p inhibition

  • Potential as therapeutic target:

    • The miR-378a-3p/TSPAN17 axis represents a potential therapeutic target in GBM

    • Enhancing miR-378a-3p expression or directly targeting TSPAN17 could have anti-tumor effects

What are the key considerations for producing and working with recombinant TSPAN17 protein?

Working with recombinant membrane proteins like TSPAN17 presents several methodological challenges:

  • Expression systems:

    • Mammalian expression systems often yield better folding of complex membrane proteins

    • Consider HEK293 or CHO cells for expression of properly folded human TSPAN17

    • Insect cell systems (Sf9, High Five) may provide alternatives for higher yield

  • Solubilization and purification:

    • Careful selection of detergents is crucial for maintaining protein stability

    • Mild detergents like DDM, LMNG, or digitonin are often suitable for tetraspanins

    • Consider adding cholesterol during purification to stabilize the protein

  • Storage and handling:

    • Small volumes of TSPAN17 recombinant protein may become entrapped in the seal of product vials during shipment and storage

    • Store with appropriate protease inhibitors and at recommended temperatures

    • Avoid freeze-thaw cycles

  • Functional assays:

    • Incorporate the protein into liposomes or nanodiscs for functional studies

    • Co-immunoprecipitation assays can verify interactions with partner proteins

    • Surface plasmon resonance (SPR) can measure binding kinetics with interacting proteins

How can researchers effectively study TSPAN17 in zebrafish models?

The zebrafish ortholog of TSPAN17 provides an opportunity for in vivo studies:

  • Gene identification and characterization:

    • The zebrafish tspan17 gene (ZDB-GENE-030131-3673) is located on chromosome 14

    • It encodes a protein predicted to be located in the plasma membrane

    • Previous aliases include fc49c03, wu:fc49c03, and zgc:158284

  • Expression analysis techniques:

    • In situ hybridization to determine spatial expression patterns

    • RT-qPCR for quantitative expression analysis during development

    • Transgenic reporter lines can be generated to visualize expression dynamically

  • Loss-of-function approaches:

    • CRISPR/Cas9 genome editing for targeted knockout

    • Morpholino antisense oligonucleotides for transient knockdown

    • Consider creating conditional knockouts if constitutive deletion is lethal

  • Phenotypic analysis:

    • Focus on neural development and function, especially dopaminergic neurons

    • Behavioral assays to assess locomotor activity and responses

    • Pharmacological challenges with 6-OHDA or dopamine receptor agonists/antagonists

What approaches can resolve contradictory findings about TSPAN17 function in different experimental systems?

Resolving contradictory findings is a common challenge in tetraspanin research:

  • Context-dependency considerations:

    • Tetraspanins like TSPAN17 may have different functions in different cell types

    • Document the cellular context precisely, including cell type, culture conditions, and passage number

    • Consider the influence of the tetraspanin web composition, which varies between cell types

  • Methodological standardization:

    • Develop standardized protocols for TSPAN17 knockdown/overexpression

    • Use multiple siRNA sequences or shRNAs to rule out off-target effects

    • Include appropriate rescue experiments to confirm specificity

  • Comprehensive interaction mapping:

    • Identify cell type-specific interaction partners using proximity labeling approaches like BioID or APEX

    • Conduct comparative interactome analyses across different cell types

    • Consider the stoichiometry of TSPAN17 and its partners

  • Integrative data analysis:

    • Combine data from multiple experimental approaches (genomic, transcriptomic, proteomic)

    • Use larger cohorts for clinical studies to increase statistical power

    • Consider meta-analysis of existing datasets to identify consistent patterns

What are promising approaches for targeting TSPAN17 therapeutically in cancer?

Based on current knowledge, several promising therapeutic approaches could be developed:

  • RNA interference-based therapeutics:

    • siRNA or shRNA delivered via nanoparticles or liposomes

    • Development of TSPAN17-specific antisense oligonucleotides

    • CRISPR/Cas9-based gene editing approaches for permanent knockout

  • miRNA-based approaches:

    • miR-378a-3p mimics to downregulate TSPAN17

    • Development of stable miRNA delivery systems targeting tumor tissues

    • Combination therapies with conventional chemotherapeutics

  • Small molecule inhibitors:

    • Target specific protein-protein interactions between TSPAN17 and partners

    • Focus on disrupting TSPAN17-ADAM10 interactions

    • High-throughput screening of compound libraries for molecules that inhibit TSPAN17 function

  • Antibody-based therapeutics:

    • Development of antibodies targeting TSPAN17 extracellular domains

    • Antibody-drug conjugates for targeted delivery to TSPAN17-expressing cells

    • CAR-T cell approaches targeting TSPAN17 in advanced cancers

How might TSPAN17 research contribute to understanding neurodegenerative diseases?

The neuroprotective role of TSP-17 in C. elegans suggests several promising research directions:

  • TSPAN17 in Parkinson's disease models:

    • Investigate TSPAN17 expression in dopaminergic neurons in mammalian models

    • Explore whether TSPAN17 variants correlate with Parkinson's disease risk

    • Test if TSPAN17 overexpression protects against neurotoxin-induced neurodegeneration

  • Dopamine transporter regulation:

    • Examine if human TSPAN17 regulates dopamine transporter (DAT) activity similar to C. elegans TSP-17

    • Investigate protein-protein interactions between TSPAN17 and DAT

    • Explore potential for TSPAN17-based therapies that modulate dopamine transport

  • Genetic studies in patient populations:

    • Screen for TSPAN17 variants in Parkinson's disease cohorts

    • Conduct association studies between TSPAN17 polymorphisms and disease risk or progression

    • Explore gene-environment interactions between TSPAN17 variants and environmental factors

  • Therapeutic potential:

    • Develop approaches to enhance TSPAN17 expression or function in vulnerable neurons

    • Test TSPAN17-based therapies in animal models of Parkinson's disease

    • Explore combination therapies targeting multiple aspects of dopaminergic neuron health

Human Tetraspanin-17 remains an intriguing protein with diverse biological functions and significant therapeutic potential across multiple disease contexts. As research progresses, our understanding of this important membrane protein will continue to expand, potentially leading to novel therapeutic strategies for both cancer and neurodegenerative diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.