Recombinant Human Tetraspanin-18 (TSPAN18)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Tetraspanin-18 (TSPAN18)

Recombinant Human Tetraspanin-18 is a 248-amino-acid protein with four transmembrane domains, expressed using heterologous systems like Escherichia coli or cell-free synthesis platforms . It is tagged (e.g., His or Strep tags) for purification and detection, enabling studies on its interaction partners and signaling mechanisms .

Key Production Platforms:

  • Bacterial Expression: Full-length TSPAN18 (1–248 aa) fused to a His tag, purified via nickel affinity chromatography .

  • Cell-Free Synthesis: Strep-tagged TSPAN18 produced in tobacco-based systems, enabling rapid yield without cellular toxicity .

Advantages:

  • E. coli: Cost-effective for large-scale production .

  • Cell-Free: Avoids misfolding issues common in transmembrane proteins .

Table 1: Common Experimental Uses

ApplicationProtocol DetailsSource
Western Blot (WB)Dilution 1:1,000–1:4,000; detected in human placenta
ELISAUsed for immunodetection with anti-TSPAN18 antibodies
Calcium Signaling AssaysFunctional studies in endothelial cells
Protein Interaction StudiesIdentified Orai1 as a key partner

Significance in Biomedical Research

Recombinant TSPAN18 enables mechanistic studies of endothelial dysfunction, thrombosis, and inflammatory diseases. Its role in Orai1 regulation offers therapeutic potential for targeting thrombo-inflammatory conditions without systemic Orai1 inhibition . Current research prioritizes structural resolution of TSPAN18-Orai1 complexes to guide drug development .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand you may have specific requirements. Please indicate any format preferences when placing your order, and we will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
TSPAN18; UNQ3042/PRO9858; Tetraspanin-18; Tspan-18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TSPAN18
Target Protein Sequence
MEGDCLSCMKYLMFVFNFFIFLGGACLLAIGIWVMVDPTGFREIVAANPLLLTGAYILLA MGGLLFLLGFLGCCGAVRENKCLLLFFFLFILIIFLAELSAAILAFIFRENLTREFFTKE LTKHYQGNNDTDVFSATWNSVMITFGCCGVNGPEDFKFASVFRLLTLDSEEVPEACCRRE PQSRDGVLLSREECLLGRSLFLNKQGCYTVILNTFETYVYLAGALAIGVLAIELFAMIFA MCLFRGIQ
Uniprot No.

Target Background

Gene References Into Functions
  1. The frequency of rs11038167 minor allele (A) was significantly higher only in female patients with thought disorder. Our result suggested that the TSPAN18 gene may be involved in the development of psychotic symptoms and contribute to clinical heterogeneity of schizophrenia. PMID: 27208512
  2. Our results showed that two SNPs (rs11038167 and rs11038172) at TSPAN18, reported as genome-wide significant SCZ risk variants in Han Chinese, were entirely monomorphic in Europeans, indicating a deep between-population divergence at this gene locus. PMID: 27312590
  3. Meta-analysis results show no significant association between TSPAN18 gene and schizophrenia in the Han Chinese population indicating the gene is unlikely to be a major susceptibility gene for schizophrenia in this population. PMID: 26016498
  4. These results confirm the significant association, in Han Chinese populations, of increased SCZ risk and the variant of the TSPAN18 gene containing the 'A' allele of SNP rs835784. PMID: 23505562
Database Links

HGNC: 20660

KEGG: hsa:90139

UniGene: Hs.385634

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is TSPAN18 expressed across different human tissues and cell types?

Expression profiling through quantitative real-time PCR (qRT-PCR) has demonstrated variable TSPAN18 expression across human tissues and cell lines. Notably, TSPAN18 shows specific expression patterns in primary cells compared to established cell lines . The gene has been detected in lung adenocarcinoma (LUAD) tissues and has prognostic significance in this context . When investigating TSPAN18 expression, researchers should consider both human tissues and murine models, as mouse Tspan18 expression profiles have been established across different tissues .

For reproducible expression analysis, it is recommended to:

  • Use validated primer sets that distinguish between isoforms

  • Include appropriate housekeeping genes as controls

  • Compare expression across normal and pathological tissues when relevant

What are the optimal storage and reconstitution conditions for recombinant TSPAN18 protein?

For maximum stability and activity, recombinant TSPAN18 protein should be:

  • Stored as a lyophilized powder at -20°C/-80°C upon receipt

  • Briefly centrifuged prior to opening to bring contents to the bottom

  • Reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Supplemented with 5-50% glycerol (final concentration) and aliquoted for long-term storage at -20°C/-80°C

Repeated freeze-thaw cycles should be avoided as they may compromise protein integrity. Working aliquots can be stored at 4°C for up to one week . When designing experiments, consider that the storage buffer typically contains Tris/PBS-based components with approximately 6% trehalose at pH 8.0 .

What cellular models are most appropriate for studying TSPAN18 function?

The selection of appropriate cellular models depends on the specific aspect of TSPAN18 being investigated:

  • DT40 B cells have been successfully used to study TSPAN18's role in NFAT/AP-1 signaling pathways. This model is particularly valuable for examining protein tyrosine kinase (PTK)-based signaling pathways .

  • Prostate cancer cell lines are suitable for investigating TSPAN18's role in cancer metastasis, particularly bone metastasis .

  • HEK-293T cells have been employed for subcellular localization studies and overexpression experiments .

When selecting a model system, consider the endogenous expression level of TSPAN18 in your chosen cell line and its expression of potential interacting partners such as STIM1.

How does TSPAN18 regulate calcium signaling pathways in different cellular contexts?

TSPAN18 plays a critical role in calcium signaling through multiple mechanisms:

For comprehensive calcium signaling studies involving TSPAN18, researchers should include:

  • Multiple calcium flux measurement techniques (e.g., fluorescent calcium indicators, electrophysiology)

  • Pharmacological inhibitors of calcium channels and pumps

  • Genetic approaches targeting specific components of calcium signaling pathways

What is TSPAN18's role in cancer progression and metastasis?

TSPAN18 has emerged as a significant factor in cancer progression through several mechanisms:

  • Prognostic Value in Lung Adenocarcinoma: TSPAN18 is part of a tetraspanin-related gene signature with prognostic value in LUAD. This signature reflects tumor immune infiltration patterns and can be used to classify patients into high and low-risk groups .

  • Bone Metastasis in Prostate Cancer: TSPAN18 facilitates bone metastasis of prostate cancer by:

    • Protecting STIM1 from TRIM32-mediated ubiquitination and degradation

    • Increasing STIM1 protein stability

    • Stimulating Ca²⁺ influx in an STIM1-dependent manner

    • Accelerating cancer cell migration and invasion

  • Clinical Correlations: Overexpression of TSPAN18 is positively associated with STIM1 protein expression, bone metastasis, and poor prognosis in prostate cancer patients .

To effectively study TSPAN18 in cancer contexts, researchers should consider:

  • Patient-derived samples to validate findings from cell line models

  • In vivo metastasis models to confirm in vitro observations

  • Multivariate analysis controlling for established prognostic factors

How do different TSPAN18 isoforms differ in structure and function?

At least two TSPAN18 isoforms have been identified with distinct structural features and potentially different functional properties:

  • Isoform 1 vs. Isoform 2: Bioinformatic analysis and sequence alignment have revealed differences between these isoforms . Notably, these isoforms may have different transmembrane domain organizations and extracellular loop structures.

  • Functional Differences: Studies have investigated whether Tspan18 isoform 1 shares the capability of activating NFAT/AP-1 with isoform 2. Experimental evidence suggests potential functional differences between these isoforms .

  • Domain-Specific Functions: Research using chimeric proteins has demonstrated that the extracellular loops of TSPAN18 are sufficient to induce NFAT/AP-1 signaling when incorporated into a different tetraspanin backbone .

For isoform-specific studies, researchers should:

  • Use isoform-specific detection methods (antibodies, primers)

  • Create isoform-specific constructs for functional studies

  • Consider potential tissue-specific expression patterns of different isoforms

What protein interactions are critical for TSPAN18 function?

Several key protein interactions define TSPAN18's functional roles:

  • STIM1 Interaction: In prostate cancer cells, TSPAN18 directly interacts with STIM1, competitively inhibiting E3 ligase TRIM32-mediated STIM1 ubiquitination and degradation. This interaction leads to increased STIM1 protein stability and enhanced Ca²⁺ signaling .

  • TRIM32 Competition: TSPAN18 competes with the E3 ligase TRIM32 for binding to STIM1, thereby protecting STIM1 from ubiquitination and subsequent degradation .

  • Signaling Pathway Independence: Notably, TSPAN18 signaling appears to be independent of certain canonical pathways:

    • Independent of Lyn/Syk and PLC𝛾 signaling

    • Independent of IP₃ receptors in some contexts

    • Conflicting evidence exists regarding STIM1 dependence

To effectively study these interactions, researchers should employ:

  • Co-immunoprecipitation and proximity ligation assays

  • Mutational analysis of binding interfaces

  • Domain swapping experiments

  • Comparative studies across different cell types

What are effective approaches for studying TSPAN18 overexpression and knockdown?

For robust TSPAN18 functional studies, consider these methodological approaches:

Overexpression Systems:

  • Transient transfection in cell lines such as DT40 and HEK-293T has been successfully employed

  • Use of epitope tags (FLAG, MYC) facilitates detection and immunoprecipitation

  • Dose-dependent effects can be assessed by titrating expression plasmid amounts

  • Consider both wildtype and mutant variants to assess structure-function relationships

Knockdown/Knockout Strategies:

  • siRNA or shRNA targeting specific TSPAN18 isoforms

  • CRISPR-Cas9 genome editing for complete knockout

  • Inducible systems to control the timing of expression changes

  • Rescue experiments with mutant variants to confirm specificity

Readout Systems:

  • NFAT/AP-1 luciferase reporter assays provide quantitative assessment of signaling activity

  • Calcium imaging for real-time monitoring of cellular calcium dynamics

  • Migration and invasion assays for cancer-related phenotypes

  • Co-immunoprecipitation for protein interaction studies

How can I assess TSPAN18's effect on NFAT/AP-1 signaling pathways?

NFAT/AP-1 signaling assessment requires multifaceted approaches:

  • Reporter Assays: The NFAT/AP-1 luciferase reporter assay in DT40 cells provides a quantitative readout of transcriptional activation. This system has successfully demonstrated dose-dependent activation by TSPAN18 .

  • Pharmacological Interventions: Strategic use of inhibitors helps delineate pathway specifics:

    • Calcium chelators (EGTA) to assess extracellular calcium dependence

    • Calcineurin inhibitors (cyclosporin A) to confirm NFAT activation mechanism

    • Calcium ionophores (ionomycin) as positive controls

    • PMA (phorbol 12-myristate 13-acetate) to assess synergistic AP-1 activation

  • Genetic Approaches: Employing cells deficient in specific signaling components (e.g., IP₃R-deficient, STIM1-knockdown) helps establish pathway dependencies .

  • Comparative Analysis: Comparing TSPAN18-induced signaling with other tetraspanins provides specificity controls and identifies unique features of TSPAN18 .

What methods are appropriate for studying TSPAN18 subcellular localization?

Multiple complementary approaches should be employed:

  • Fluorescence Microscopy:

    • Epitope-tagged TSPAN18 constructs can be visualized using immunofluorescence

    • Co-localization studies with organelle markers help determine specific subcellular compartments

    • Live-cell imaging can track dynamic localization changes

  • Biochemical Fractionation:

    • Lipid raft isolation through detergent-resistant membrane preparation

    • Cellular fractionation to separate membrane, cytosolic, and nuclear components

    • Sucrose gradient ultracentrifugation for membrane microdomain analysis

  • Structure-Function Analysis:

    • Chimeric proteins incorporating domains from other tetraspanins

    • Mutagenesis of key residues (e.g., glycosylation sites, palmitoylation sites)

    • Truncation mutants to identify localization signals

Research has demonstrated that transfected TSPAN18, similar to CD9 and Tspan9, does not localize to lipid rafts in HEK-293T cells .

What are the considerations for studying TSPAN18 in cancer contexts?

For cancer-related TSPAN18 research, consider:

  • Model Selection:

    • Cell lines representative of cancer type and stage

    • Patient-derived xenografts for translational relevance

    • In vivo metastasis models, particularly for bone metastasis studies in prostate cancer

  • Clinical Correlation:

    • Analysis of TSPAN18 expression in patient samples

    • Correlation with clinical outcomes (survival, metastasis)

    • Multivariate analysis including established prognostic factors

  • Mechanistic Studies:

    • Investigation of STIM1-TSPAN18-TRIM32 regulatory axis

    • Calcium signaling pathways in cancer progression

    • Interaction with tumor microenvironment components

  • Therapeutic Implications:

    • Targeted inhibition of TSPAN18 or its interactions

    • Combination approaches targeting both TSPAN18 and interacting partners

    • Biomarker potential in risk stratification

How can I resolve conflicting data regarding TSPAN18's interaction with STIM1?

The literature presents contradictory findings regarding TSPAN18-STIM1 interaction:

  • Prostate Cancer Studies: Indicate TSPAN18 directly interacts with STIM1 and influences calcium signaling in an STIM1-dependent manner .

  • DT40 Cell Studies: Suggest TSPAN18 signaling is independent of STIM1 .

To address these contradictions, consider:

  • Cell Type Specificity: The dependency on STIM1 may vary across cell types due to different expression levels of other interacting proteins or compensatory mechanisms.

  • Isoform Differences: Different TSPAN18 isoforms might interact distinctly with STIM1.

  • Methodological Variations: Different techniques for assessing dependency could yield different results.

  • Context-Dependent Interactions: The interaction might be regulated by cellular conditions or activation states.

Recommended approaches:

  • Perform parallel experiments in multiple cell lines

  • Use both genetic and pharmacological approaches to modulate STIM1

  • Compare different TSPAN18 isoforms in the same experimental system

  • Employ multiple protein interaction detection methods

What controls should be included in TSPAN18 functional studies?

Rigorous controls are essential for reliable TSPAN18 research:

  • Expression Controls:

    • Empty vector transfections

    • Related tetraspanins (e.g., CD9, Tspan9) to assess specificity

    • Dose-matched expression levels when comparing mutants or variants

  • Signaling Pathway Controls:

    • Positive controls: ionomycin for calcium-dependent signaling, PMA for AP-1 activation

    • Inhibitor controls: cyclosporin A for calcineurin dependence, EGTA for calcium dependence

    • Genetic controls: cells deficient in specific signaling components

  • Mutant Controls:

    • Conservative versus non-conservative mutations

    • Domain swaps with related tetraspanins

    • Glycosylation and palmitoylation site mutants

  • Technical Controls:

    • Multiple independent experimental replicates

    • Different detection methods for key findings

    • Validation in multiple cell types when possible

How can I optimize the purification and functional analysis of recombinant TSPAN18?

For optimal results with recombinant TSPAN18:

  • Purification Optimization:

    • Use tagless or minimally tagged versions when possible to avoid interference with function

    • Consider detergent selection carefully for membrane protein solubilization

    • Validate proper folding using conformation-sensitive antibodies or functional assays

  • Reconstitution Considerations:

    • Follow recommended reconstitution in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol for stability during long-term storage

    • Avoid repeated freeze-thaw cycles by creating single-use aliquots

  • Functional Validation:

    • Calcium flux assays to confirm activity

    • Binding assays with known partners like STIM1

    • Cell-based assays that can detect TSPAN18-dependent phenotypes

  • Quality Control:

    • SDS-PAGE to confirm purity (>90% recommended)

    • Mass spectrometry to confirm identity and potential modifications

    • Circular dichroism to assess secondary structure elements typical of tetraspanins

What approaches help resolve discrepancies in TSPAN18 expression data across studies?

To reconcile varying TSPAN18 expression findings:

  • Technical Standardization:

    • Use validated primer sets for qRT-PCR that distinguish between isoforms

    • Include multiple reference genes for normalization

    • Apply consistent thresholds for calling positive expression

  • Sample Considerations:

    • Account for tissue heterogeneity through microdissection or single-cell approaches

    • Consider disease state, as expression may change in pathological conditions

    • Document demographic and clinical variables that may influence expression

  • Comprehensive Profiling:

    • Combine RNA and protein detection methods

    • Use both bulk and single-cell approaches

    • Profile across comprehensive tissue panels and disease states

  • Meta-Analysis Approaches:

    • Integrate data from multiple studies with appropriate statistical methods

    • Account for batch effects and different technical platforms

    • Consider creating normalized expression scores across datasets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.