Recombinant Human Tetraspanin-33 (TSPAN33)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Biological Systems

Recombinant TSPAN33 is used to study its native functions:

  • Immune Regulation:

    • B Cell Activation: Upregulated in activated B cells (4-fold increase post-LPS stimulation) .

    • Membrane Dynamics: Modulates plasma membrane tension, affecting B cell adhesion, migration, and phagocytosis .

    • Signal Transduction: Associates with integrins and tetraspanin-enriched microdomains (TEMs) to regulate TLR signaling and cytoskeletal reorganization .

  • Clinical Relevance:

    • Expressed in Hodgkin’s lymphoma, diffuse large B-cell lymphoma (DLBCL), and autoimmune diseases (e.g., SLE, rheumatoid arthritis) .

    • Potential therapeutic target due to its absence in resting B cells .

Research Applications

Recombinant TSPAN33 is critical for:

  • Flow Cytometry: Detects TSPAN33 expression in activated human PBMCs (e.g., CD40L/IL-4-stimulated B cells) .

  • Disease Modeling: Used to study lymphoma biology and autoimmune mechanisms .

  • Mechanistic Studies: Investigates roles in erythroid differentiation and Notch signaling .

ApplicationExperimental UseKey Findings
B Cell ActivationqRT-PCR and IHC in lymphoma biopsies High TSPAN33 in Reed-Sternberg cells (Hodgkin’s) and DLBCL
Membrane MechanicsOverexpression in Raji B cells Reduced phagocytosis, altered integrin distribution, enhanced migration
Therapeutic DevelopmentKnockdown models Inverse correlation between TSPAN33 and B cell quiescence

Production and Quality Control

Recombinant TSPAN33 is synthesized using cell-free systems with stringent quality standards:

  • Purity: ≥85% verified by SDS-PAGE .

  • Storage: Stable at -20°C or -80°C in glycerol-containing buffers .

  • Validation: Specificity confirmed via flow cytometry using isotype controls .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSPAN33; PEN; Tetraspanin-33; Tspan-33; Penumbra; hPen; Proerythroblast new membrane
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TSPAN33
Target Protein Sequence
MARRPRAPAASGEEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACL AVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSD KARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSR ERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLG GVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY
Uniprot No.

Target Background

Function
Tetraspanin-33 (TSPAN33) plays a crucial role in normal erythropoiesis. It contributes to the differentiation of erythroid progenitors. TSPAN33 regulates the maturation and trafficking of the transmembrane metalloprotease ADAM10. It negatively regulates ligand-induced Notch activity, likely by modulating ADAM10 activity. TSPAN33 mediates the docking of ADAM10 to zonula adherens through interactions with ADAM10 and, in a PDZD11-dependent manner, with the zonula adherens protein PLEKHA7.
Gene References Into Functions
  1. Research indicates that TSPAN33 represents a novel regulatory element in macrophage inflammation development, potentially serving as a therapeutic target. PMID: 27574297
  2. Findings demonstrate that tetraspanin 33 (TSPAN33) is an early activation marker, and disintegrin and metalloproteinase domain-containing protein 10 (ADAM10) protein expression does not correlate with TSPAN33 expression in B cells. PMID: 28449222
  3. TSPAN33 is overexpressed in activated and malignant B cells. PMID: 24211713
Database Links

HGNC: 28743

OMIM: 610120

KEGG: hsa:340348

STRING: 9606.ENSP00000289407

UniGene: Hs.27267

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, adherens junction. Cytoplasm.
Tissue Specificity
Predominantly expressed in erythroblasts.

Q&A

What is the molecular structure and cellular distribution of Human Tetraspanin-33 (TSPAN33)?

TSPAN33 belongs to the tetraspanin superfamily of transmembrane proteins that establish lateral associations with other molecules, determining their activity and localization within the cell membrane . Research using overexpression models in human Raji cells has revealed that TSPAN33 has a specific distribution that includes membrane microvilli, the Golgi apparatus, and extracellular vesicles . Like other tetraspanins, TSPAN33 contributes to the formation of specialized membrane microdomains that facilitate signal transduction and membrane organization.

The protein contains four transmembrane domains with two extracellular loops that mediate interactions with partner proteins. These interactions are critical for the functional specialization of regions within the plasma membrane, particularly in immune cells where membrane dynamics play essential roles in cellular functions.

How is TSPAN33 expression regulated in different immune cell types?

TSPAN33 expression shows distinct regulation patterns across immune cell types:

Table 1: Regulation of TSPAN33 Expression in Immune Cells

Cell TypeStimulusEffect on TSPAN33 ExpressionRegulatory Mechanism
MacrophagesTLR4 activationIncreasedNOTCH-dependent
MacrophagesTLR3 activationIncreasedNOTCH-dependent
MacrophagesTLR2 activationIncreasedNOTCH-dependent
MacrophagesIFN-γEnhancedNOTCH-dependent
MacrophagesNOTCH1/2 knockdownDiminishedDirect regulation
MacrophagesConstitutively active NOTCH1EnhancedDirect induction

TSPAN33 is the member of the TspanC8 tetraspanin subgroup most intensely induced during macrophage activation . This induction is largely dependent on NOTCH signaling, as expression is diminished in macrophages lacking Notch1 and Notch2, but enhanced after overexpression of constitutively active intracellular domain of NOTCH1 .

What methodologies are most effective for studying TSPAN33 function in immune cells?

Based on published research, several complementary approaches have proven effective:

  • Overexpression and knockdown models: Studies have successfully employed TSPAN33 overexpression in human Raji cells to study its distribution and function, while knockdown approaches demonstrate opposite phenotypes, providing valuable validation .

  • siRNA targeting: For investigating signaling pathways like NOTCH, siRNAs targeting TSPAN33 have effectively demonstrated its role as a positive factor in NOTCH1 activity .

  • Functional assays:

    • Phagocytosis assays to measure TSPAN33's impact on engulfment capacity

    • Cell adhesion assays to assess integrin function and cellular attachment

    • Chemotaxis and invasion assays to quantify migratory phenotypes

    • Membrane mechanics measurements during fibronectin-induced spreading

  • Protein interaction studies: Co-immunoprecipitation and proximity ligation assays to identify binding partners, particularly with ADAM10 and components of the NOTCH signaling pathway .

For optimal results, research should combine multiple approaches to provide comprehensive and corroborating evidence of TSPAN33 function.

How can researchers accurately measure TSPAN33's effects on plasma membrane mechanics?

Investigating TSPAN33's impact on membrane mechanics requires specialized methodologies:

  • Fibronectin-induced spreading assays:

    • Coat surfaces with fibronectin at defined concentrations

    • Seed cells expressing different levels of TSPAN33 (normal, overexpressed, knockdown)

    • Measure spreading dynamics over time using live cell imaging

    • Quantify cell area, circularity, and protrusion formation

  • Membrane roughness and tension measurements:

    • Atomic force microscopy (AFM) to measure nanoscale membrane topology changes

    • Membrane tether-pulling techniques to quantify effective membrane tension

    • Fluorescence recovery after photobleaching (FRAP) to assess membrane protein mobility

  • Quantitative analysis of cytoskeletal interactions:

    • Immunofluorescence co-localization with cytoskeletal elements

    • Measurement of F-actin remodeling during cell spreading

    • Analysis of focal adhesion formation and turnover

Research has demonstrated that TSPAN33 expression inhibits changes in roughness and membrane tension during fibronectin-induced spreading, suggesting it serves as a regulator of membrane mechanical properties .

How does TSPAN33 regulate B lymphocyte migration and adhesion properties?

TSPAN33 serves as a critical regulatory element of B lymphocyte adhesion and migration through multiple mechanisms:

Table 2: Effects of TSPAN33 on B Lymphocyte Adhesion and Migration

TSPAN33 StatusAdhesion PhenotypeMigration PhenotypeUnderlying Mechanism
OverexpressionImpairedEnhanced chemotaxis and invasionAberrant integrin expression
KnockdownEnhancedReduced chemotaxis and invasionNormalized integrin expression

The molecular basis for these effects involves:

  • Integrin regulation: TSPAN33 alters the expression patterns of integrins, critical adhesion molecules that mediate interactions with extracellular matrix components and other cells .

  • Membrane-cytoskeleton coupling: Similar to other tetraspanins like CD9, TSPAN33 likely influences tyrosine phosphorylation levels that promote β1 integrin-dependent mobility in B cells .

  • Membrane mechanics modulation: By regulating membrane tension and roughness, TSPAN33 affects the physical properties that govern cellular protrusion formation and migration dynamics .

This research suggests TSPAN33 as a potential target for modulating B cell migration in contexts where abnormal lymphocyte trafficking contributes to pathology.

What is the relationship between TSPAN33 and phagocytic function in B lymphocytes?

Research has identified a clear inverse relationship between TSPAN33 expression and phagocytic capacity:

  • Overexpression effects: B lymphocytes overexpressing TSPAN33 demonstrate significantly diminished phagocytic ability compared to control cells .

  • Knockdown effects: Conversely, TSPAN33 knockdown cells display enhanced phagocytic capacity, further confirming the inhibitory role of this tetraspanin on phagocytosis .

  • Potential mechanisms:

    • Altered plasma membrane organization affecting phagocytic receptor distribution

    • Modified membrane curvature properties inhibiting phagosome formation

    • Disrupted cytoskeletal remodeling necessary for particle engulfment

    • Perturbed signaling cascades that normally activate the phagocytic machinery

These findings suggest that TSPAN33 levels must be precisely regulated for optimal phagocytic function in B cells, and that therapeutic modulation of TSPAN33 could potentially enhance or suppress phagocytic capacity in clinical contexts.

How does TSPAN33 interact with the NOTCH signaling pathway?

TSPAN33 plays a significant role in regulating NOTCH signaling through multiple interaction points:

Table 3: TSPAN33 Interactions with NOTCH Signaling Components

NOTCH Pathway ComponentEffect of TSPAN33Functional OutcomeEvidence
NOTCH1Promotes constitutive activityEnhanced signalingsiRNA knockdown reduces NOTCH1 activity
γ-secretase complexFacilitates cleavage stepIncreased NOTCH activationAffects NOTCH processing
ADAM10Increases maturationEnhanced NOTCH processingPromotes protease maturation
Presenilin1Modulates activityIncreased NOTCH signalingAffects γ-secretase function

Experimental evidence from knockdown studies shows that depletion of TSPAN33 causes a strong and reproducible reduction in the activity of NOTCH1 mutant alleles . Additionally, TSPAN33 favors NOTCH processing at the membrane by modulating ADAM10 and/or Presenilin1 activity, thus increasing NOTCH signaling in activated macrophages .

Interestingly, TSPAN33 expression is itself regulated by NOTCH signaling, creating a potential positive feedback loop that could amplify NOTCH-dependent responses .

What is the molecular basis of TSPAN33's effect on ADAM10 maturation?

TSPAN33 belongs to the TspanC8 subgroup of tetraspanins known to regulate ADAM10:

  • Selective protease regulation: TSPAN33 increases ADAM10 maturation but does not affect ADAM17, demonstrating specificity in its regulatory function .

  • Molecular mechanism:

    • TSPAN33 likely facilitates ADAM10 trafficking from the endoplasmic reticulum to the Golgi

    • It may stabilize mature ADAM10 at the cell surface by forming tetraspanin-enriched microdomains

    • TSPAN33 potentially modulates ADAM10 substrate specificity, favoring NOTCH processing

  • Functional consequences:

    • Enhanced ADAM10-mediated S2 cleavage of NOTCH receptors

    • Increased generation of NOTCH intracellular domain (NICD)

    • Amplified NOTCH-dependent transcriptional activity

This relationship between TSPAN33 and ADAM10 represents a novel regulatory mechanism in NOTCH signaling with implications for immune cell activation and function .

What are the implications of TSPAN33 in inflammatory conditions and potential therapeutic targeting?

TSPAN33's role in immune cell function suggests significant implications for inflammatory conditions:

  • Inflammation regulation:

    • TSPAN33 modulates TLR-induced proinflammatory gene expression

    • It increases NF-κB-dependent transcriptional activity, a master regulator of inflammation

    • Its upregulation during macrophage activation suggests involvement in inflammatory responses

  • Potential therapeutic applications:

    • Inhibition of TSPAN33 could reduce excessive macrophage-driven inflammation

    • Modulation could alter B cell migration in autoimmune conditions

    • Targeting TSPAN33-ADAM10 interaction could affect NOTCH-dependent inflammatory processes

  • Experimental therapeutic approaches:

    • Small molecule inhibitors of TSPAN33-partner protein interactions

    • Antibodies targeting the extracellular domains of TSPAN33

    • siRNA/shRNA approaches for localized TSPAN33 knockdown

    • CRISPR/Cas9-mediated editing of TSPAN33 regulatory elements

Researchers have suggested that TSPAN33 represents a novel control element in the development of inflammation by macrophages that could constitute a potential therapeutic target .

How should researchers approach contradictory findings about TSPAN33 function?

Resolving contradictions in TSPAN33 research requires systematic experimental approaches:

  • Contextual analysis:

    • Cell type specificity: Effects may differ between B cells, macrophages, and other immune cells

    • Activation state dependency: Function may vary between resting and activated cells

    • Microenvironmental factors: Matrix composition and cytokine milieu may affect outcomes

  • Methodological considerations:

    • Expression level effects: Overexpression versus physiological versus knockdown

    • Temporal dynamics: Acute versus chronic modulation of TSPAN33

    • In vitro versus in vivo disparities: Cell culture findings may not translate to whole organisms

  • Molecular interaction mapping:

    • Comprehensive interactome analysis across different cellular contexts

    • Competition between interaction partners under different conditions

    • Post-translational modifications affecting protein-protein interactions

  • Experimental design recommendations:

    • Multi-parametric analysis combining multiple readouts simultaneously

    • Dose-response studies to identify threshold effects

    • Genetic background considerations when using different cell lines or animal models

    • Combined loss-and-gain-of-function approaches in parallel experimental systems

This systematic approach can help reconcile apparently contradictory findings by revealing the context-dependent nature of TSPAN33 function across different experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.