Recombinant Human Tetraspanin-5 (TSPAN5)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human TSPAN5

Recombinant Human TSPAN5 is a synthetic form of the transmembrane protein belonging to the tetraspanin superfamily (TM4SF). It is produced using recombinant DNA technology, enabling controlled expression and purification for experimental use. Unlike endogenous TSPAN5, recombinant variants often include affinity tags (e.g., N-terminal or C-terminal tags) to enhance solubility, stability, or detection during assays .

Functional Roles and Mechanisms

Recombinant TSPAN5 is pivotal for studying:

  • ADAM10 Regulation: Facilitates ADAM10 maturation and trafficking to the cell surface, promoting cleavage of substrates like CD44 .

  • Synaptic Function: Modulates AMPA receptor (AMPAR) exocytosis by interacting with adaptor proteins AP-4 and Stargazin, influencing synaptic plasticity .

  • Cancer Pathways: In hepatocellular carcinoma (HCC), TSPAN5 depletion triggers oncogene-induced senescence via p16INK4a/pRb pathways and disrupts MRTF-A/FLNA complex formation, reducing tumor growth .

Table 1: Key Studies Using Recombinant TSPAN5

Study FocusMethodologyKey FindingReference
ADAM10 InteractionGST pulldown assaysTSPAN5 C-terminus binds AP-4 complex, regulating AMPAR trafficking .
Cancer SenescenceshRNA knockdown in HCC cellsTSPAN5 loss induces senescence via actin polymerization defects .
Neuronal DevelopmentHippocampal neuron modelsTSPAN5 knockdown reduces dendritic spines and GluA2 recycling .

Table 2: Recombinant TSPAN5 Properties

ParameterDetail
Molecular Weight~25–30 kDa (varies with tags)
TagsN-terminal (e.g., His-tag), optional C-terminal
Purity>95% (SDS-PAGE verified)
SolubilityRequires detergents (e.g., Triton X-100) for membrane protein stability .

Challenges and Future Directions

While recombinant TSPAN5 enables mechanistic studies, limitations include:

  • Tag interference with native protein interactions.

  • Limited structural data on recombinant vs. endogenous conformations.
    Future work should prioritize cryo-EM structures and high-throughput screening for therapeutic targeting in cancer and neurological disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TSPAN5; TM4SF9; Tetraspanin-5; Tspan-5; Tetraspan NET-4; Transmembrane 4 superfamily member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TSPAN5
Target Protein Sequence
MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFD PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC GVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF IGIALLQIFGICLAQNLVSDIEAVRASW
Uniprot No.

Target Background

Function

Recombinant Human Tetraspanin-5 (TSPAN5) regulates ADAM10 maturation and trafficking to the cell surface, promoting ADAM10-mediated cleavage of CD44.

Gene References Into Functions
  1. TSPAN5 intensity in villi during tubal pregnancy was significantly higher than in normal intrauterine pregnancy. PMID: 29908376
  2. TSPAN5 may serve as a prognostic biomarker for gastric cancer, functioning as a tumor suppressor to control tumor growth. PMID: 27223087
  3. Endothelial TSPAN5- and TSPAN17-ADAM10 complexes may regulate inflammation by maintaining VE-cadherin expression and promoting T lymphocyte transmigration. PMID: 28600292
  4. Two TspanC8-specific motifs in TSPAN5's large extracellular domain are crucial for ADAM10 interaction and endoplasmic reticulum exit. An anti-TSPAN5 monoclonal antibody (mAb) does not recognize TSPAN5 associated with ADAM10, offering a method to quantify the unbound fraction of TSPAN5. PMID: 28428248
Database Links

HGNC: 17753

OMIM: 613136

KEGG: hsa:10098

STRING: 9606.ENSP00000307701

UniGene: Hs.118118

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of TSPAN5 and how does it organize within cell membranes?

TSPAN5 belongs to the tetraspanin superfamily, characterized by four transmembrane domains, two extracellular loops (with the second extracellular domain EC2 being larger), and one intracellular loop. Unlike direct receptor molecules, tetraspanins like TSPAN5 organize themselves with other membrane proteins into specialized microdomains known as tetraspanin-enriched microdomains (TEMs). Within TEMs, TSPAN5 establishes connections with the actin cytoskeleton, which influences multiple cellular processes including adhesion, migration, invasion, and signal transduction .

Methodologically, researchers studying TSPAN5 structure often utilize crosslinking experiments with agents like bis(sulfosuccinimidyl)suberate (BS3), which being membrane-impermeable, only crosslinks plasma membrane proteins. This technique helps differentiate between surface and intracellular pools of TSPAN5. Crosslinked TSPAN5 appears as high molecular weight bands on western blots, while the intracellular pool runs at the expected molecular weight .

How is TSPAN5 expression regulated at the transcriptional level?

TSPAN5 expression is regulated by specific transcription factors that bind to regulatory regions in its promoter. Electrophoretic mobility shift assays have revealed differences in nuclear protein binding patterns between wild-type and variant SNP sequences for three SNPs (rs1918743, rs59961429, and rs56095565) in the TSPAN5 regulatory region. Luciferase reporter assays with these SNP variants showed decreased transcriptional activity in neuroblastoma cells compared to wild-type sequences .

The regulation of TSPAN5 expression appears to be tissue-specific. SNPs that act as expression quantitative trait loci (eQTLs) for TSPAN5 show different directional effects depending on the tissue examined. For instance, variant alleles are associated with lower TSPAN5 expression in brain tissue and lymphoblastoid cell lines, but with higher expression in blood samples .

What are the optimal expression systems for producing recombinant TSPAN5 protein?

While mammalian expression systems are theoretically preferable for producing properly folded TSPAN5 protein with appropriate post-translational modifications, bacterial expression systems have been more widely used in practice. Attempts to express TSPAN5 EC2 domains in mammalian or insect cells have encountered challenges despite confirmation of DNA integration into host genomes and detection of EC2-encoding mRNA .

For bacterial expression, the extracellular domain 2 (EC2) of TSPAN5 is commonly produced as a GST fusion protein. This approach, though successful for protein production, comes with inherent limitations including potential LPS contamination and suboptimal protein folding. To address these concerns, researchers should implement rigorous purification protocols including affinity chromatography followed by size exclusion chromatography to remove contaminants. Circular dichroism (CD) spectroscopy should be employed to verify proper secondary structure formation, with properly folded TSPAN5 EC2 domains expected to display approximately 50% α-helical structure .

What techniques are most effective for studying TSPAN5 subcellular localization?

Investigation of TSPAN5 subcellular localization requires a multi-faceted approach. Confocal microscopy with immunofluorescence labeling remains the gold standard, particularly when combined with markers for specific cellular compartments. In neurons, co-localization studies with GFP-tagged Rab proteins (Rab4, Rab7, and Rab11) have revealed that TSPAN5 predominantly associates with recycling endosomes, showing highest colocalization with Rab11-GFP (Mander's M1 coefficient: 0.94±0.02) compared to Rab4-GFP (0.77±0.02) and Rab7-GFP (0.79±0.06) .

For quantitative assessment of surface versus intracellular pools, crosslinking experiments with BS3 followed by western blotting provide valuable insights. This technique has demonstrated that TSPAN5 exists in both membrane and intracellular pools, with the intracellular proportion increasing during neuronal maturation. Additionally, surface biotinylation assays can be employed to specifically label and isolate plasma membrane TSPAN5 for further analysis .

How does TSPAN5 contribute to hepatocellular carcinoma progression?

TSPAN5 plays a critical role in hepatocellular carcinoma (HCC) progression, particularly in tumors characterized by deleted in liver cancer 1 (DLC1) loss, which occurs in approximately 50% of liver cancers. Microarray analyses in HepG2 DLC1 knockdown cells revealed significant upregulation of TSPAN5 expression. Functional studies have confirmed that TSPAN5 is required for HCC growth, migration, and invasion .

At the molecular level, TSPAN5 influences actin cytoskeleton dynamics, specifically affecting actin polymerization and the formation of myocardin-related transcription factor A (MRTF-A) and filamin A (FLNA) complexes. This complex formation is essential for MRTF transcriptional activity. When TSPAN5 is depleted, the reduction in actin polymerization decreases MRTF-A-FLNA complex formation, resulting in reduced expression of MRTF/SRF-dependent target genes .

Notably, TSPAN5 depletion induces oncogene-induced senescence (OIS) through activation of the p16INK4a/pRb pathway both in vitro and in vivo. This senescence response represents a potential therapeutic mechanism, suggesting that targeting TSPAN5 could be an effective strategy for treating HCC, particularly in tumors with DLC1 deficiency .

What methodologies reveal TSPAN5's role in AMPA receptor trafficking in neurons?

To investigate TSPAN5's role in AMPA receptor trafficking, researchers employ a combination of genetic manipulation and quantitative imaging techniques. The knockdown of TSPAN5 in rat hippocampal neurons (transfected at DIV12 and analyzed at DIV20) using shRNA constructs, followed by rescue experiments with shRNA-resistant TSPAN5, provides a powerful experimental paradigm .

Surface levels of AMPA receptor subunits are typically quantified using immunofluorescence with antibodies specific to extracellular epitopes in non-permeabilized conditions. This approach has revealed that TSPAN5 knockdown specifically reduces surface GluA2 subunit levels while paradoxically increasing GluA1 levels. These effects are reversed in rescue conditions, confirming TSPAN5's specific role. Compartment-specific analysis, focusing separately on dendritic spines versus shafts, provides additional spatial resolution to understand TSPAN5's influence on postsynaptic AMPAR distribution .

Molecular interaction studies have demonstrated that TSPAN5 mediates AMPAR exocytosis through interactions with the adaptor protein complex AP4 and the auxiliary protein Stargazin. This trafficking likely utilizes recycling endosomes as a delivery route, as evidenced by high colocalization with Rab11-positive structures in confocal microscopy studies .

How does TSPAN5 influence serotonin pathway regulation in relation to SSRI response?

TSPAN5 has emerged as a significant factor in serotonin regulation and antidepressant response. Genetic variants upstream of TSPAN5 have been associated with baseline plasma serotonin concentrations and the magnitude of serotonin decrease during selective serotonin reuptake inhibitor (SSRI) therapy in patients with major depressive disorder (MDD). Specifically, minor allele variants are linked to higher baseline plasma serotonin levels and greater reductions during SSRI treatment .

Mechanistically, functional genomic studies in neuroblastoma SK-N-BE(2) cells have demonstrated that TSPAN5 expression levels directly influence the expression of key serotonin pathway enzymes. TSPAN5 knockdown (>70% reduction) significantly decreases mRNA and protein levels of tryptophan hydroxylase 1 and 2 (TPH1, TPH2), dopa decarboxylase (DDC), monoamine oxidase A (MAOA), and the serotonin transporter (SLC6A4). Conversely, TSPAN5 overexpression increases expression of these enzymes .

Researchers investigating TSPAN5's role in serotonin regulation should employ qRT-PCR and western blotting to measure expression changes in serotonin pathway components following TSPAN5 manipulation. Neuronal cell models (particularly SK-N-BE(2) cells) are recommended as they express both TSPAN5 and serotonin pathway enzymes at detectable levels .

What are the optimal methods for investigating TSPAN5 protein interactions?

Investigating TSPAN5 protein interactions requires specialized approaches due to its membrane-embedded nature and organization within tetraspanin-enriched microdomains (TEMs). Co-immunoprecipitation studies should be performed using mild detergents (such as CHAPS or Brij series) that preserve tetraspanin-tetraspanin interactions and associated proteins. More stringent detergents like Triton X-100 can be employed to distinguish direct (primary) from indirect (secondary) interactions within TEMs .

For identifying novel TSPAN5 interaction partners, proximity-based labeling techniques such as BioID or APEX2 are particularly valuable. These methods allow for biotinylation of proteins in close proximity to TSPAN5 in living cells, followed by streptavidin pulldown and mass spectrometry analysis. This approach has advantages over traditional co-immunoprecipitation in capturing transient or weak interactions that might occur in specialized membrane domains .

Functional validation of TSPAN5 interactions can be achieved through domain-specific mutations or chimeric constructs, particularly focusing on the EC2 domain which typically mediates specific interactions. For instance, analysis of TSPAN5's interaction with AP4 and Stargazin has provided insights into its role in AMPAR trafficking in neurons .

How can researchers effectively perform TSPAN5 genetic manipulation studies?

For genetic manipulation of TSPAN5, researchers should select appropriate experimental systems based on their specific research questions. In neurobiological studies, rat or mouse hippocampal neurons provide a physiologically relevant context, while HepG2 cells are suitable for hepatocellular carcinoma research .

For knockdown experiments, shRNA constructs targeting different regions of TSPAN5 should be validated for knockdown efficiency (>70% reduction is typically desired) using both qRT-PCR and western blotting. Rescue experiments with shRNA-resistant TSPAN5 constructs are essential to confirm specificity and rule out off-target effects. For overexpression studies, careful consideration of expression levels is important, as excessive expression of membrane proteins may lead to mislocalization or aggregation .

CRISPR-Cas9 genome editing represents the most advanced approach for TSPAN5 functional studies, allowing for complete knockout or the introduction of specific mutations, such as those identified in genetic association studies. When designing CRISPR experiments, researchers should target conserved regions essential for protein function and implement appropriate controls to account for potential off-target effects .

How do TSPAN5 genetic variants influence clinical outcomes and therapeutic responses?

TSPAN5 genetic variants, particularly SNPs in the regulatory region, have significant clinical implications. In a study of 306 MDD patients from the Mayo Clinic Pharmacogenomics Research Network Antidepressant Medication Pharmacogenomics Study (PGRN-AMPS), specific TSPAN5 SNPs were associated with baseline plasma serotonin levels and changes in serotonin concentration during SSRI therapy .

The minor allele frequency for SNPs 5' of TSPAN5 was approximately 7% in European-American MDD patients, consistent with the 6.7% value reported for European populations in the 1000 Genomes Project. Researchers conducting genetic association studies should consider this relatively low frequency when planning sample sizes to ensure adequate statistical power for detecting homozygous variant effects .

Analysis of TSPAN5 variants as expression quantitative trait loci (eQTLs) reveals tissue-specific effects, with brain and lymphoblastoid cell lines showing decreased TSPAN5 expression with variant alleles, while blood samples show increased expression. This tissue-specificity is critical for interpreting genetic associations with neuropsychiatric phenotypes and highlights the importance of studying relevant tissue types .

SNPEffect on TranscriptionTissueDirectionalityStudy Method
rs1918743, rs59961429, rs56095565Altered TF bindingSK-N-BE(2) cellsDecreased with variantEMSA, Luciferase assay
TSPAN5 5' SNPseQTLBrain (cerebral/frontal cortex)Decreased with variantBRAINEAC database
TSPAN5 5' SNPseQTLBlood (5311 samples)Increased with variantBlood eQTL browser
TSPAN5 5' SNPseQTLLymphoblastoid cell linesDecreased with variantqRT-PCR analysis

What are the methodological challenges in translating TSPAN5 research to therapeutic applications?

Developing therapeutic approaches targeting TSPAN5 presents several methodological challenges. As a membrane protein with four transmembrane domains, TSPAN5 lacks easily accessible enzymatic activity that could be targeted by small molecule inhibitors. Instead, therapeutic strategies might focus on disrupting specific protein-protein interactions or modulating TSPAN5 expression levels .

Clinical translation also requires validated biomarkers of TSPAN5 activity. While plasma serotonin levels have been associated with TSPAN5 variants in MDD patients, more direct measurements of TSPAN5 function in relevant tissues remain challenging. Future research should focus on identifying accessible biomarkers that reliably reflect TSPAN5 activity in target tissues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.