Recombinant Human Tetraspanin-6 (TSPAN6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Tetraspanin-6 (TSPAN6)

Recombinant Human TSPAN6 is a synthetic version of the endogenous TSPAN6 protein, a member of the tetraspanin family (transmembrane 4 superfamily). These proteins are characterized by four transmembrane domains and are involved in cell signaling, membrane organization, and tumor suppression. TSPAN6 has gained attention for its role in regulating EGFR-RAS signaling pathways and its potential as a therapeutic target in cancer .

Role in Cancer Biology

TSPAN6 functions as a tumor suppressor in multiple cancers:

Mechanism of Action

  1. EGFR-RAS Signaling Inhibition:

    • Binds to EGFR, blocking phosphorylation and downstream RAS-ERK activation

    • Reduces TGF-α secretion by forming a complex with TGF-α and syntenin-1

  2. Epithelial-Mesenchymal Transition (EMT) Suppression:

    • Maintains epithelial morphology by promoting E-cadherin expression

    • Inhibits vimentin and fra-1 expression, markers of mesenchymal transition

Cancer-Specific Findings

Cancer TypeTSPAN6 RoleClinical Correlation
Colorectal (CRC)Predicts response to cetuximabLow expression → Poor survival
PancreaticInhibits tumor growth/metastasisLow expression → EMT phenotype
LungSupresses KRAS-driven carcinogenesisLow expression → Poor prognosis

In Vitro Studies

  • TSPAN6 Overexpression:

    • Reduces proliferation in KRAS-mutant pancreatic cell lines (PANC1, MIA PaCa2)

    • Suppresses EGFR phosphorylation (Y1173) by 40-60% in EGF-stimulated cells

  • TSPAN6 Knockdown:

    • Induces invasive spiking in 3D MCF10A acini cultures

    • Enhances metastasis in orthotopic pancreatic cancer models

In Vivo Models

ModelOutcomeSource
Tspan6 KO mice (Kras)Increased lung tumor initiation
PANC1 orthotopic50% reduction in tumor growth
EpRas mammary tumorsEnhanced metastasis to lungs

Biomarker Potential

  • CRC: TSPAN6 expression independently predicts cetuximab response beyond RAS/RAF status

  • Pancreatic/Lung: Low TSPAN6 correlates with mesenchymal morphology and poor survival

Therapeutic Strategies

  1. Recombinant TSPAN6:

    • Potential for targeted delivery to restore tumor suppressor function

    • Preclinical studies show efficacy in reducing metastasis

  2. Gene Therapy:

    • Overexpression in KRAS-mutant cancers to inhibit EMT and proliferation

Future Directions

  1. Multi-Omic Profiling:

    • Investigate TSPAN6 interactions with other tetraspanins (e.g., TSPAN29/CD9)

    • Map TSPAN6-dependent extracellular vesicle regulation

  2. Therapeutic Trials:

    • Phase I/II trials combining TSPAN6-based therapies with EGFR inhibitors

    • Biomarker validation in diverse cancer cohorts

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
TSPAN6; TM4SF6; UNQ767/PRO1560; Tetraspanin-6; Tspan-6; A15 homolog; Putative NF-kappa-B-activating protein 321; T245 protein; Tetraspanin TM4-D; Transmembrane 4 superfamily member 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TSPAN6
Target Protein Sequence
MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKN SFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKL EDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV
Uniprot No.

Target Background

Gene References Into Functions
  1. TSPAN6 plays a crucial role in Amyloid Precursor Protein-C-terminal fragment turnover. (PMID: 28279219)
  2. TSPAN6 acts as a negative regulator of the RLR pathway through ubiquitination-dependent interaction with MAVS. (PMID: 22908223)
Database Links

HGNC: 11858

OMIM: 300191

KEGG: hsa:7105

STRING: 9606.ENSP00000362111

UniGene: Hs.43233

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of human TSPAN6 and how does it compare to other tetraspanins?

Recombinant human TSPAN6 is a member of the tetraspanin family, characterized by four transmembrane domains that form small and large extracellular loops. The protein contains a canonical PDZ-binding motif at its C-terminus, which facilitates interactions with PDZ domain-containing proteins such as syntenin. Surface plasmon resonance (SPR) experiments have demonstrated that TSPAN6 directly interacts with the PDZ domains of recombinant syntenin through this motif, with the interaction abolished when the last three C-terminal residues are deleted . Unlike some other tetraspanins that promote extracellular vesicle formation, TSPAN6 uniquely functions as a negative regulator of exosome production.

What are the primary cellular functions of TSPAN6 in normal tissues?

TSPAN6 primarily functions as a membrane scaffold protein that regulates protein trafficking, membrane organization, and signal transduction. Key cellular functions include:

  • Negative regulation of exosome production by directing syndecan-4 (SDC4) and syntenin to lysosomal degradation rather than extracellular secretion

  • Inhibition of syndecan-4 ectodomain shedding, similar to the effects of matrix metalloproteinase inhibitors

  • Modulation of EGFR signaling through direct binding that affects downstream pathway activation

  • Maintenance of epithelial cell identity through suppression of epithelial-to-mesenchymal transition (EMT)

  • Formation of tripartite complexes with transmembrane TGF-α and syntenin-1 to regulate TGF-α secretion

How does TSPAN6 expression vary across different cancer types and what are the clinical implications?

TSPAN6 exhibits remarkable tissue-specific expression patterns in cancer with opposing clinical implications:

This contradictory expression pattern across cancer types suggests context-dependent functions that may reflect differences in tissue-specific signaling environments, genetic backgrounds, or tumor microenvironments .

What mechanisms underlie TSPAN6's tumor suppressor function in Ras-driven cancers?

TSPAN6 acts as a tumor suppressor in Ras-driven cancers through several complementary mechanisms:

  • Direct binding to EGFR, leading to suppression of EGFR-RAS-ERK signaling pathways

  • Specific inhibition of EGFR-induced RAS activation, resulting in reduced phosphorylation of EGFR, ERK1/2, and P38 at both basal levels and following EGFR stimulation

  • Differential regulation of signaling pathways: inhibiting EGFR-RAS-ERK signaling while paradoxically enhancing PI3K-AKT-TOR signaling

  • Promotion of epithelial cell morphology and inhibition of epithelial-to-mesenchymal transition

  • Reduced cell proliferation, invasion, and migration in vitro and suppressed tumor growth and metastatic dissemination in vivo

How does TSPAN6 influence tumor microenvironment and immune response in cancer?

TSPAN6 plays a significant role in shaping the tumor microenvironment and modulating immune responses:

  • Expression positively correlates with macrophage and neutrophil infiltration in tumors

  • Co-expression with several immune checkpoint genes has been observed, suggesting a regulatory role in immune checkpoint signaling

  • Downregulation of TSPAN6 reduces the recruitment of macrophages in experimental models

  • TSPAN6 expression levels may predict response to immune checkpoint blockade therapy, highlighting its potential as a biomarker for immunotherapy efficacy

How does TSPAN6 regulate exosome production at the molecular level?

TSPAN6 negatively regulates exosome production through several interconnected mechanisms:

  • Forms tight associations with syndecan-4 (SDC4), directing the SDC4-TSPAN6 complex to lysosomal degradation rather than exosomal secretion

  • This association controls interaction between TSPAN6 and syntenin, leading to TSPAN6-dependent lysosomal degradation of the SDC4-syntenin complex

  • Inhibits shedding of the SDC4 ectodomain, mimicking effects of matrix metalloproteinase inhibitors

  • Cellular levels of TSPAN6 act as a molecular switch: low levels permit exosomal syntenin and SDC4 secretion, while high levels direct these components toward lysosomal degradation

Nanoparticle tracking analyses have demonstrated that TSPAN6 depletion increases the total number of secreted particles without affecting their size, while TSPAN6 overexpression decreases exosome production .

What is the mechanism of interaction between TSPAN6 and EGFR, and how does this affect downstream signaling?

TSPAN6 physically interacts with EGFR and modulates its signaling with remarkable pathway specificity:

  • Direct binding of TSPAN6 to EGFR reduces receptor phosphorylation at tyrosine 1173 following EGF stimulation, indicating effects on proximal EGFR signaling

  • TSPAN6 expression specifically attenuates the EGFR-RAS-ERK signaling arm, reducing phosphorylation of EGFR, ERK1/2, and P38

  • Paradoxically, TSPAN6 enhances the PI3K-AKT-TOR signaling pathway, as evidenced by increased phosphorylation of AKT1/2/3 and TOR in TSPAN6-expressing cells

  • This differential effect effectively rewires EGFR signaling, potentially shifting cellular responses from proliferation and migration (ERK-dependent) toward other cellular functions regulated by PI3K-AKT

What complexes does TSPAN6 form with syntenin and other proteins, and what are their functional implications?

TSPAN6 forms several functionally important protein complexes:

  • Direct interaction with syntenin through its C-terminal PDZ-binding motif, confirmed by surface plasmon resonance experiments

  • Tripartite complex with transmembrane TGF-α and syntenin-1, which negatively regulates TGF-α secretion in colorectal cancer cells

  • Association with syndecan-4, which determines the fate of the SDC4-syntenin complex (lysosomal degradation versus exosomal secretion)

  • Potential interactions with EGFR-associated signaling complexes that influence pathway-specific activation

These complexes have significant functional implications, determining protein trafficking pathways, regulating growth factor availability, and modulating receptor signaling dynamics to influence cellular phenotypes and cancer progression .

What are the most effective techniques for studying TSPAN6 protein-protein interactions?

Several complementary approaches have proven effective for studying TSPAN6 protein-protein interactions:

TechniqueApplication for TSPAN6 ResearchAdvantagesExample Usage
GFP-Trap Co-IPIdentifying TSPAN6 binding partnersEnables pull-down of protein complexes from cell lysatesUsed to identify TSPAN6-syntenin interactions under different detergent conditions (NP-40, Brij97)
Surface Plasmon Resonance (SPR)Direct measurement of binding kineticsQuantifies binding affinities and confirms direct interactionsDemonstrated direct interaction between TSPAN6 and syntenin PDZ domains
Mass SpectrometryUnbiased identification of interaction partnersIdentifies novel binding partners and quantifies relative abundancesAnalyzed proteins associated with GFP-TSPAN6 versus GFP alone using label-free LC-MS/MS
Proximity Ligation AssaysIn situ detection of protein interactionsVisualizes interactions in native cellular contextsUseful for confirming TSPAN6 interactions with membrane proteins
Fluorescence MicroscopyColocalization analysisExamines spatial relationships between TSPAN6 and potential partnersValuable for studying dynamic interactions in live cells

The most robust approach combines multiple techniques, starting with unbiased proteomics (MS) followed by validation using direct binding assays (SPR) and cellular confirmation (Co-IP) .

What experimental models are most appropriate for studying TSPAN6 function in cancer?

Multiple experimental models have proven valuable for investigating TSPAN6 function in cancer:

In vitro models:

  • Cancer cell lines with TSPAN6 knockdown or overexpression (e.g., MCF-7, PANC1, MIA PaCa2, U251)

  • 3D culture systems for studying invasive properties and epithelial sheet migration

  • Transwell migration and scratch assays to evaluate effects on cell motility

In vivo models:

  • Orthotopic xenograft models to assess tumor growth and metastasis in pancreatic cancer

  • Genetic mouse models with whole-body or tissue-specific knockout of Tspan6 crossed with Kras-driven cancer models

  • APCmin/+ mice with Tspan6 knockout to study colorectal adenoma formation

Clinical samples:

  • Analysis of TSPAN6 expression in patient samples from clinical trials (e.g., COIN trial for EGFR-targeted therapy)

  • TCGA and GEO database analyses for correlating TSPAN6 expression with clinical outcomes across cancer types

The selection of appropriate models should be guided by the specific research question, considering the context-dependent effects of TSPAN6 in different cancer types .

How should researchers approach contradictory data regarding TSPAN6 expression and function in different cancer types?

The contradictory reports of TSPAN6 expression and function across cancer types represent a genuine biological phenomenon rather than methodological inconsistencies. Researchers should:

How reliable is TSPAN6 as a biomarker for cancer prognosis and therapeutic response?

TSPAN6 shows promise as a biomarker for both prognosis and therapeutic response:

Prognostic value:

  • Low TSPAN6 expression correlates with poor survival in colorectal and pancreatic cancers

  • High TSPAN6 expression associates with unfavorable outcomes in gliomas

  • These tissue-specific correlations suggest TSPAN6 could serve as a contextual prognostic marker

Predictive value for therapy response:

  • TSPAN6 expression in colorectal cancer correlates with better patient responses to Cetuximab (EGFR-targeted therapy), independent of tumor molecular profile

  • Co-expression with immune checkpoint molecules suggests potential value in predicting immunotherapy response

For reliable clinical application, standardized assessment methods and validation in large, diverse cohorts are essential, with consideration of cancer-specific thresholds and integration with other biomarkers .

What therapeutic strategies could target TSPAN6 or its regulatory pathways in cancer treatment?

Therapeutic approaches involving TSPAN6 would need to be highly context-dependent:

For cancers with decreased TSPAN6 expression (colorectal, pancreatic, lung):

  • Strategies to restore or increase TSPAN6 expression could leverage its tumor suppressor functions

  • Development of small molecules or peptides that mimic TSPAN6's interaction with EGFR could inhibit EGFR-RAS-ERK signaling

  • Targeting pathways that negatively regulate TSPAN6 expression to indirectly restore its levels

For cancers with increased TSPAN6 expression associated with poor outcomes (gliomas):

  • Inhibition of TSPAN6 expression or function could potentially slow tumor progression

  • Targeting TSPAN6-dependent immune cell recruitment might favorably alter the tumor microenvironment

  • Combination approaches with immune checkpoint inhibitors could enhance immunotherapy efficacy

These approaches would require careful evaluation of tissue-specific effects and potential off-target consequences given TSPAN6's involvement in fundamental cellular processes .

How does TSPAN6 expression influence response to EGFR-targeted therapies and immunotherapies?

TSPAN6 expression appears to significantly impact response to both EGFR-targeted therapies and potentially immunotherapies:

EGFR-targeted therapies:

  • Analysis of samples from the EGFR-targeting COIN clinical trial demonstrated that TSPAN6 expression in colorectal cancer correlated with better patient responses to Cetuximab

  • This correlation was independent of tumor molecular profile, suggesting TSPAN6 provides additional predictive value beyond established biomarkers

  • The mechanistic basis is supported by TSPAN6's direct interaction with EGFR and suppression of EGFR-RAS-ERK signaling

Immunotherapies:

  • TSPAN6 expression correlates with immune checkpoint gene expression in gliomas

  • High TSPAN6 associates with increased immune cell infiltration, particularly macrophages and neutrophils

  • These associations suggest TSPAN6 could potentially serve as a predictor of response to immune checkpoint blockade therapy

Integration of TSPAN6 expression analysis into treatment decision algorithms could potentially improve patient stratification for both targeted therapies and immunotherapies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.