Recombinant Human Thioredoxin-related transmembrane protein 4 (TMX4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development to meet your specifications.
Synonyms
TMX4; KIAA1162; TXNDC13; PSEC0095; UNQ475/PRO938; Thioredoxin-related transmembrane protein 4; Thioredoxin domain-containing protein 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-349
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMX4
Target Protein Sequence
TAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWEAFAKNGEI LQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYILEKKWQSV EPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLFM GLVLVVISECFYVPLPRHLSERSEQNRRSEEAHRAEQLQDAEEEKDDSNEEENKDSLVDD EEEKEDLGDEDEAEEEEEEDNLAAGVDEERSEANDQGPPGEDGVTREEVEPEEAEEGISE QPCPADTEVVEDSLRQRKSQHADKGL
Uniprot No.

Target Background

Gene References Into Functions
  1. Research identified a novel transmembrane Trx-like protein 4 (TMX4) within the endoplasmic reticulum (ER) of mammalian cells. In vitro studies confirmed reductase activity in its Trx-like domain. PMID: 20056998
  2. Analysis revealed that TMX4 possesses unique features not commonly observed in other protein disulfide isomerases (PDIs), suggesting distinct functional properties. PMID: 19811453
Database Links

HGNC: 25237

KEGG: hsa:56255

STRING: 9606.ENSP00000246024

UniGene: Hs.169358

Subcellular Location
Nucleus inner membrane; Single-pass type I membrane protein.

Q&A

What is TMX4 and where is it localized in cells?

TMX4 (Thioredoxin-related transmembrane protein 4, also known as TXNDC13 or PDIA14) is a type I transmembrane protein primarily localized to the endoplasmic reticulum (ER) membrane. It belongs to the thioredoxin superfamily and is part of a small family of five thioredoxin-related transmembrane proteins (TMX) that reside in the ER membrane .

TMX4 has a unique distribution pattern compared to other PDI family members, showing peculiar enrichment in the nuclear envelope (NE) . This specialized localization suggests TMX4 has evolved functions beyond general protein folding in the ER, particularly in nuclear envelope dynamics and structure regulation.

Methodological approach for subcellular localization studies:

  • Immunofluorescence using specific anti-TMX4 antibodies with HepG2 cells shows both ER and nuclear envelope distribution

  • Expression of tagged TMX4 constructs (HA-tagged or V5-tagged) followed by microscopy

  • Proteinase protection assays to determine membrane topology and orientation of functional domains

What is the structure and domain organization of TMX4?

TMX4 is a 349 amino acid protein with several key structural features:

  • N-terminal signal sequence (cleavable)

  • Luminal N-terminal region containing a single thioredoxin-like domain

  • One N-glycosylation site in the luminal region

  • A non-canonical CPSC (Cysteine-Proline-Serine-Cysteine) active site motif

  • Single transmembrane domain

  • C-terminal cytosolic tail containing two phosphorylation sites (Ser251 and Ser259)

  • An RQR sequence near the C-terminus that may function in ER targeting

The CPSC motif in TMX4 is located on a coiled linker connecting a β-strand and an α-helix, allowing for a highly divergent configuration. This structural arrangement enables the thiol groups to adopt varying orientations from synperiplanar to antiperiplanar conformations, contributing to TMX4's reductase activity and substrate specificity .

How is the expression of TMX4 regulated in different tissues and conditions?

TMX4 mRNA is ubiquitously expressed across human tissues, with particularly high levels reported in heart tissue . Northern blot analysis using a human multiple-tissue Northern blot has confirmed this widespread distribution pattern . At the protein level, TMX4 has been detected in various tissues including brain, heart, testis, and multiple cell lines .

Unlike many ER chaperones and oxidoreductases, TMX4 is not upregulated during ER stress conditions, which is consistent with the absence of an ER stress response element (ERSE) in its promoter region . Experimental evidence shows that TMX4 mRNA levels do not increase in response to ER stress inducers like thapsigargin, tunicamycin, or DTT after 6 hours of treatment .

This constitutive expression pattern suggests TMX4 has housekeeping functions that are not primarily linked to adaptive responses to ER stress.

What are the enzymatic properties of TMX4?

TMX4 possesses several key enzymatic properties that dictate its function:

  • Redox potential: The redox potential of TMX4's thioredoxin-like domain has been measured at -171.5 mV (at 30°C, pH 7.0), indicating it could function as a reductase in the ER environment .

  • Reductase activity: Using a purified recombinant protein containing the Trx-like domain of TMX4 (TMX4-Trx), studies have confirmed this domain has reductase activity in vitro .

  • Redox state changes: A maleimide alkylation assay showed that the catalytic CPSC motif undergoes changes in its redox state depending on cellular redox conditions. In normal cellular conditions, most endogenous TMX4 exists in the oxidized form .

  • Active site properties: The CPSC active site of TMX4 contains a proline at position 2 that destabilizes the disulfide state and favors the di-thiol reduced form, contributing to its reductase activity .

Experimental approach for determining redox properties:

  • Purification of recombinant TMX4-Trx domain using bacterial expression systems

  • Redox potential determination through equilibration with glutathione redox buffers

  • Visualization of redox state through alkylation with AMS or mPEG2K-mal followed by SDS-PAGE analysis

How can researchers effectively express and purify recombinant TMX4 for in vitro studies?

For successful expression and purification of recombinant TMX4, researchers should consider the following protocol based on published methodologies:

  • Construct design:

    • For full-length TMX4: Human TMX4 cDNA (e.g., DDBJ accession number AK075404) can be subcloned into pCDNA3.1(+) with an HA tag at the C-terminus

    • For the catalytic domain: The Trx-like domain region (amino acids 35-185) can be subcloned into pCold-TF, which incorporates a His6 tag and trigger factor (TF) at the N-terminus

  • Expression system:

    • E. coli is suitable for expression of the soluble Trx-like domain

    • Mammalian cell lines (HEK293, COS-7) are preferable for full-length transmembrane protein

  • Purification strategy:

    • Initial capture via HisTrap column

    • Cleavage of the TF portion using HRV3C protease

    • Removal of cleaved TF and uncleaved fusion protein using a second HisTrap column

    • Further purification via ion exchange (Resource Q column) and gel filtration (HiLoad 16/60 Superdex 75pg)

  • Quality control:

    • Verify protein folding via circular dichroism (CD) spectroscopy

    • Confirm activity through reductase assays

    • Check for aggregation via analytical ultracentrifugation or dynamic light scattering

This approach yields purified recombinant TMX4-Trx that can be used for in vitro enzymatic assays, structural studies, and interaction analyses.

What methods are most effective for studying TMX4 protein-protein interactions?

Several complementary approaches have proven effective for studying TMX4's interactions:

  • Co-immunoprecipitation with trapping mutants:

    • Generate a TMX4-C67A "trapping mutant" by replacing the second cysteine in the CPSC motif with alanine

    • This mutation stabilizes mixed disulfide intermediates with client proteins

    • Co-express TMX4-C67A with tagged potential partners (e.g., HALO-tagged NESPRIN3)

    • Immunoprecipitate using antibodies against either protein

    • Analyze complexes by non-reducing SDS-PAGE followed by western blotting

  • Mass spectrometry identification of interaction partners:

    • Express tagged TMX4-C67A in appropriate cell lines

    • Immunoprecipitate the protein complex

    • Identify interacting proteins through mass spectrometry

    • This approach identified NESPRIN1 and NESPRIN2 as major TMX4 clients

  • Proximity labeling approaches:

    • Fuse TMX4 to a proximity labeling enzyme (BioID or APEX)

    • Identify proteins in close proximity to TMX4 in living cells

    • This can reveal both stable and transient interactions in native cellular environments

  • In vitro binding assays:

    • Use purified recombinant TMX4-Trx to test direct interactions

    • Surface plasmon resonance or isothermal titration calorimetry can determine binding affinity

    • Pull-down assays with GST-tagged or His-tagged proteins can confirm interactions

These methods revealed that TMX4 interacts with calnexin, ERp57, and NESPRIN proteins, suggesting roles in both protein folding and nuclear envelope dynamics .

How can researchers analyze the redox state of TMX4 in cells?

Analyzing the redox state of TMX4 requires techniques that can preserve and detect the thiol-disulfide status of its active site:

  • Maleimide alkylation assay:

    • Treat cells with trichloroacetic acid (10%) to rapidly acidify and precipitate proteins, preventing further thiol-disulfide exchange

    • Solubilize precipitated proteins in buffer containing SDS

    • Alkylate free thiol groups with maleimide reagents such as:

      • 4-acetamido-4′-maleidylstilbene-2,2′-disulfonic acid (AMS)

      • Methoxypolyethylene glycol-maleimide (mPEG2K-mal)

    • Analyze by SDS-PAGE and western blotting with anti-TMX4 antibodies

    • The oxidized and reduced forms can be distinguished by their differential mobility

  • Diagonal redox 2D-PAGE:

    • Separate proteins under non-reducing conditions in the first dimension

    • Cut out the lane and run it under reducing conditions in the second dimension

    • Proteins with disulfide bonds will appear off the diagonal

    • Identify TMX4 and its disulfide-bonded partners by immunoblotting or mass spectrometry

  • Redox Western blotting:

    • Treat cells with or without oxidizing/reducing agents (e.g., diamide, DTT)

    • Extract proteins under non-reducing conditions

    • Block free thiols with N-ethylmaleimide (NEM)

    • Reduce oxidized thiols with DTT and label with a different alkylating agent

    • Detect by immunoblotting to visualize different redox forms

These approaches have shown that under normal cellular conditions, most endogenous TMX4 exists in the oxidized form, but its redox state changes in response to cellular redox conditions .

What is the role of TMX4 in nuclear envelope dynamics and LINC complex regulation?

TMX4 plays a specialized role in nuclear envelope dynamics through its interaction with components of the Linker of Nucleoskeleton and Cytoskeleton (LINC) complexes:

  • Interaction with NESPRIN proteins:

    • TMX4 engages NESPRIN proteins (NESPRIN1, NESPRIN2, NESPRIN3) through mixed disulfide bonds

    • These interactions appear specific to TMX4, as other TMX family members (TMX1, TMX3, TMX5) did not show similar interactions

    • The TMX4-C67A trapping mutant stabilizes these mixed disulfide intermediates for experimental detection

  • Redox-dependent regulation of LINC complexes:

    • LINC complexes contain structural intermolecular disulfide bonds between SUN and NESPRIN proteins

    • TMX4's reductase activity catalyzes the reduction of these disulfide bonds

    • This reduction facilitates disassembly of LINC complexes during cellular processes requiring nuclear envelope remodeling

  • Role in asymmetric autophagy of the nuclear envelope:

    • TMX4 works in coordination with SEC62, an autophagy receptor

    • Together they regulate the lysosomal delivery of outer nuclear membrane (ONM) portions

    • TMX4-driven redox events segregate ONM portions to be removed from the inner nuclear membrane (INM)

    • This specificity preserves the INM, which directly contacts genetic material

This function represents a novel role for TMX4 beyond classical protein folding activities and suggests it has evolved specialized functions in maintaining nuclear envelope integrity during cellular stress and remodeling processes.

How does TMX4 contribute to protein folding in the ER compared to other PDI family members?

TMX4's contribution to protein folding in the ER has several distinguishing features compared to other PDI family members:

  • Enzymatic activity and substrate specificity:

    • TMX4 functions primarily as a reductase (redox potential -171.5 mV)

    • The unique structural features of its CPSC active site, located on a coiled linker connecting a β-strand and an α-helix, allows for conformational flexibility

    • This structural arrangement differs from other PDIs and likely influences substrate recognition

  • Integration with folding machinery:

    • TMX4 interacts with calnexin and ERp57, key components of glycoprotein folding

    • It could function within this complex to:

      • Directly modify clients as a reductase

      • Maintain ERp57 in a reduced state to promote its function as an oxidase

  • Comparison with other TMX proteins:

TMX MemberActive SitePrimary FunctionKey InteractionsUnique Features
TMX1CPACReductaseTransmembrane proteins, ERAD machineryPreferentially acts on membrane proteins
TMX2SNDCLikely redox-inactiveUnknownMutations linked to neurological disorders
TMX3CGHCIsomeraseAcetylcholine receptorsMultiple thioredoxin domains (a, b, b')
TMX4CPSCReductaseCalnexin, ERp57, NESPRINsNuclear envelope enrichment
TMX5CRFSUnknownUnknownPossibly Golgi-localized
  • Role in protein quality control:

    • Unlike TMX1, TMX4 does not appear to directly facilitate ER-associated degradation (ERAD)

    • Its knockdown had no effect on the degradation rate of the α1-antitrypsin NHK variant

    • This suggests functional specialization among TMX family members

These differences highlight how TMX4 has evolved specialized functions within the broader context of ER protein quality control, with particular emphasis on structural dynamics of the nuclear envelope rather than general protein folding or degradation.

What experimental approaches can identify TMX4 substrates and interaction partners?

Identifying the substrates and interaction partners of TMX4 requires specialized techniques that can capture both stable complexes and transient enzymatic interactions:

  • Trapping mutant approach:

    • Generate TMX4-C67A by replacing the second cysteine in the CPSC active site with alanine

    • This mutation disrupts the catalytic cycle, trapping mixed disulfide intermediates

    • Express in appropriate cell lines, immunoprecipitate, and identify trapped substrates by:

      • Western blotting for specific candidate proteins

      • Mass spectrometry for unbiased identification

    • This approach identified NESPRIN proteins as major TMX4 clients

  • Cross-linking mass spectrometry:

    • Treat cells expressing TMX4 with chemical cross-linkers

    • Isolate TMX4 complexes and analyze by mass spectrometry

    • This can capture both covalent and non-covalent interactions

    • Provides structural information about interaction interfaces

  • Comparative proteomics with TMX4 knockdown/knockout:

    • Generate TMX4-depleted cells using siRNA or CRISPR/Cas9

    • Compare the proteome, secretome, or redox proteome with control cells

    • Identify proteins whose abundance, secretion, or redox state changes

    • This can reveal TMX4-dependent processes beyond direct interactions

  • Client validation strategies:

    • For candidate substrates, assess:

      • Direct binding using purified recombinant proteins

      • Redox-dependent interactions through non-reducing/reducing SDS-PAGE

      • Functional dependency through rescue experiments with wild-type vs. catalytically inactive TMX4

    • Example: The NESPRIN3-TMX4 interaction was validated using co-immunoprecipitation under non-reducing conditions, followed by reducing conditions to confirm disulfide-dependent association

These approaches can be combined to build a comprehensive understanding of TMX4's substrates and partners in different cellular contexts.

What are the implications of TMX4 in disease processes and potential therapeutic applications?

While direct disease associations for TMX4 are currently limited compared to other TMX family members, several aspects suggest potential clinical relevance:

  • Current disease associations:

    • According to the clinical implications table of TMX family members, TMX4 (gene location 20p12.3; MIM 616766) has no reported direct disease associations

    • This contrasts with other TMX family members that have established links to specific conditions:

      • TMX1: Melanoma

      • TMX2: Microcephaly, polymicrogyria

      • TMX3: Microphthalmia, anophthalmia, coronary artery disease

      • TMX5: Meckel–Gruber syndrome

  • Potential involvement in nuclear envelope disorders:

    • TMX4's role in nuclear envelope dynamics through NESPRIN regulation suggests possible implications for:

      • Nuclear envelopathies (diseases caused by mutations in nuclear envelope proteins)

      • Conditions characterized by defects in nuclear structure or nucleocytoplasmic transport

      • Cellular stress responses involving nuclear envelope remodeling

    • Mutations in NESPRIN proteins, which are TMX4 clients, are associated with Emery-Dreifuss muscular dystrophy and other myopathies

  • Therapeutic potential:

    • As a membrane-associated protein with enzymatic activity, TMX4 represents a potential drug target

    • Small molecule modulators of TMX4 could potentially regulate:

      • Nuclear envelope dynamics in disease states

      • Specific protein folding pathways in the ER

      • Cellular responses to stress conditions

    • The specialized localization and substrate specificity of TMX4 could allow for targeted interventions with minimal off-target effects

  • Research directions for disease relevance:

    • Analyze TMX4 expression and activity in tissue samples from patients with nuclear envelope disorders

    • Investigate potential genetic variations in TMX4 in large population databases

    • Develop mouse models with TMX4 mutations to assess phenotypic consequences

    • Explore the relationship between TMX4 and cellular stress responses in disease contexts

As research on TMX4 continues to evolve, more specific disease associations and therapeutic applications are likely to emerge, particularly in contexts involving nuclear envelope dynamics and specialized ER functions.

How do post-translational modifications regulate TMX4 function?

Several post-translational modifications influence TMX4 function and provide regulatory mechanisms for its activity:

  • N-glycosylation:

    • TMX4 contains one consensus N-glycosylation site in its luminal region

    • This modification has been experimentally verified by endoglycosidase H sensitivity

    • Potential functional implications include:

      • Proper folding and stability of TMX4 itself

      • Interactions with calnexin during TMX4 maturation

      • Recognition of glycosylated substrates within the ER

  • Phosphorylation:

    • Two phosphorylation sites (Ser251 and Ser259) have been identified within TMX4's C-terminal cytosolic tail

    • These modifications may modulate:

      • Sub-ER localization through recruitment of binding partners

      • Distribution between general ER and nuclear envelope enrichment

      • Interactions with cytosolic factors that could influence TMX4 function

  • Redox modifications:

    • The catalytic CPSC motif undergoes dynamic oxidation/reduction

    • In normal conditions, most endogenous TMX4 exists in the oxidized form

    • These redox changes directly affect TMX4's enzymatic activity and substrate interactions

    • The redox state responds to cellular conditions, suggesting regulatory mechanisms

  • Experimental approaches to study modifications:

    • N-glycosylation: Treatment with endoglycosidases followed by mobility shift analysis

    • Phosphorylation: Phospho-specific antibodies, mass spectrometry, or 32P labeling

    • Redox state: Maleimide alkylation assays using AMS or mPEG2K-mal

    • Site-directed mutagenesis of modification sites to assess functional consequences

Understanding these modifications and their regulation is crucial for comprehending how TMX4 function is fine-tuned in different cellular contexts and how it might be modulated for experimental or therapeutic purposes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.