Recombinant Human TLC domain-containing protein 2 (TLCD2)

Shipped with Ice Packs
In Stock

Description

Functional Role

TLCD2 regulates plasma membrane composition and fluidity via two mechanisms:

  1. Inhibition of LCPUFA incorporation: Reduces omega-3 polyunsaturated fatty acids (e.g., EPA, DHA) in phospholipids, promoting membrane rigidity .

  2. Mitochondrial interaction: Modifies phosphatidylethanolamine (PE) composition in mitochondria, influencing metabolic processes .

Key functional evidence includes:

  • Knockdown studies: TLCD2 siRNA in HEK293 cells increases 18:2 and 20:5 LCPUFAs in phosphatidylcholine (PC) and PE by 30–50%, counteracting palmitic acid (PA)-induced membrane rigidification .

  • AdipoR2 interaction: TLCD2 suppression rescues membrane fluidity defects in AdipoR2-deficient cells, restoring PUFA levels and reducing ceramide accumulation .

Production Methods

Recombinant TLCD2 is produced using two primary systems:

ParameterE. coli Expression Cell-Free Synthesis
HostEscherichia coliNicotiana tabacum lysate
TagN-terminal His tagStrep tag
Amino Acid Range1–310 (Mouse ortholog) 1–264 (Human)
PurityNot specified>70–80% (SDS-PAGE/SEC)
ApplicationsStructural studiesELISA, Western blot, functional assays

The cell-free system enables post-translational modifications and complex folding, making it preferable for functional studies .

Membrane Fluidity Regulation

  • TLCD2 limits LCPUFA-containing phospholipids, reducing oxidative stress risks from peroxidizable PUFAs .

  • In HEK293 cells, TLCD2 knockdown increases LA (18:2) incorporation into PCs and PEs by 40% within 6 hours .

Disease Relevance

  • Non-alcoholic steatohepatitis (NASH): Tlcd1/2 double-knockout mice show reduced hepatic MUFA-PE species and attenuated NASH progression .

  • Cancer: TLCD2 is expressed in 20 cancer types, with elevated levels in colorectal and lung cancers , though its direct oncogenic role remains unconfirmed.

Applications in Research

  • Lipidomics: Used to study phospholipid remodeling and membrane dynamics .

  • Drug discovery: Target for metabolic disorders (e.g., NASH) due to its role in hepatic PE metabolism .

  • Structural biology: Recombinant TLCD2 facilitates crystallization and domain-function mapping .

Key Challenges

  • Functional redundancy: TLCD1/2 double knockdown is often required to observe significant phenotypic changes .

  • Mechanistic ambiguity: The exact enzymatic activity (e.g., acyltransferase vs. lipid transporter) remains debated .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TLCD2; TLC domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TLCD2
Target Protein Sequence
MAPTGLLVAGASFLAFRGLHWGLRRLPTPESAARDRWQWWNLCVSLAHSLLSGTGALLGL SLYPQMAADPIHGHPRWALVLVAVSVGYFLADGADLLWNQTLGKTWDLLCHHLVVVSCLS TAVLSGHYVGFSMVSLLLELNSACLHLRKLLLLSRQAPSLAFSVTSWASLATLALFRLVP LGWMSLWLFRQHHQVPLALVTLGGIGLVTVGIMSIILGIRILVNDVLQSRPHPPSPGHEK TRGTRTRRDNGPVTSNSSTLSLKD
Uniprot No.

Target Background

Function

Recombinant Human TLC domain-containing protein 2 (TLCD2) regulates plasma membrane composition and fluidity. It inhibits the incorporation of membrane-fluidizing phospholipids containing omega-3 long-chain polyunsaturated fatty acids (LCPUFA), thereby promoting membrane rigidity. It does not appear to affect LCPUFA synthesis.

Database Links

HGNC: 33522

KEGG: hsa:727910

STRING: 9606.ENSP00000331965

UniGene: Hs.531005

Protein Families
TLCD family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TLCD2 and where is it expressed in human tissues?

TLCD2 (TLC domain-containing protein 2) is a transmembrane protein characterized by the presence of a TLC domain, distantly related to ER-localized ceramide synthases and translocation associated membrane proteins. It is expressed in various human tissues, with strongest expression in heart, muscle, liver, small intestine, and adipose tissue . Unlike many other TLC domain-containing proteins that localize to the endoplasmic reticulum, TLCD2 is found predominantly in the plasma membrane .

What is the primary function of TLCD2 in cellular membranes?

TLCD2 functions primarily as a regulator of membrane lipid composition by limiting the incorporation of long-chain polyunsaturated fatty acids (LCPUFAs) into membrane phospholipids . This regulation has direct consequences on membrane fluidity and cellular responses to lipid stress. TLCD2 appears to limit the formation of LCPUFA-containing phospholipids rather than promote their turnover, as demonstrated through isotope labeling studies .

How does TLCD2 relate to membrane phospholipid composition?

TLCD2 specifically regulates the fatty acid composition of phosphatidylethanolamine (PE), a major phospholipid in cellular membranes . Research shows that TLCD2 promotes the incorporation of monounsaturated fatty acids (MUFAs) into PEs . In Tlcd1/2 double-knockout (DKO) mice, hepatic MUFA-containing PE species are significantly reduced, with corresponding increases in saturated fatty acid (SFA)-containing PEs .

What experimental models are available for studying TLCD2 function?

Several experimental models have been developed to study TLCD2 function:

  • Cell culture models: siRNA knockdown of TLCD2 in human HEK293 cells has been used to study its role in membrane fluidity regulation .

  • Knockout mouse models: Tlcd1/2 double-knockout mice have been generated to study the physiological roles of these proteins in vivo .

  • CRISPR-edited human cell lines: TLCD1/2 double-knockout clones in human hepatocellular carcinoma cell lines demonstrate conserved function in regulating PE composition .

  • Protein overexpression models: Stable human HepG2 and HeLa cell lines expressing HA-tagged TLCD1 or TLCD2 proteins have been used for localization and interaction studies .

What methods are effective for analyzing TLCD2-mediated changes in membrane lipid composition?

Lipidomic analysis is the primary approach for assessing TLCD2-mediated changes in membrane lipid composition. Researchers have employed:

  • Mass spectrometry-based lipidomics to quantify changes in phospholipid species composition in both whole cells and isolated organelles .

  • Isotope labeling studies using 13C-labeled LCPUFAs (e.g., linoleic acid) to monitor incorporation and clearance rates in phospholipids .

  • Subcellular fractionation to isolate mitochondria and analyze organelle-specific changes in phospholipid composition .

  • Membrane fluidity assays to correlate lipid compositional changes with functional membrane properties .

How can researchers effectively measure TLCD2 protein interactions?

To map TLCD2 protein interactions, researchers have employed:

  • Immunoprecipitation (IP) coupled with proteomics to identify protein interactors of HA-tagged TLCD1 and TLCD2 .

  • Comparative interactomics between human TLCD proteins and their C. elegans homolog (FLD-1) to identify evolutionarily conserved interactions .

  • Subcellular localization studies using tagged proteins and fluorescence microscopy to determine intracellular distribution and potential co-localization with other cellular components .

How does TLCD2 affect cellular responses to lipid stress?

TLCD2 plays a crucial role in cellular responses to lipid stress, particularly saturated fatty acid-induced membrane rigidification:

  • Knockdown of TLCD2 protects human HEK293 cells from palmitic acid (PA)-induced membrane rigidification .

  • TLCD2 knockdown also protects cells from PA-induced apoptosis, suggesting a role in lipotoxicity responses .

  • TLCD2 knockdown suppresses membrane rigidification in cells where AdipoR2 has been knocked down, which increases sensitivity to the effect of PA on membrane rigidification .

What is the relationship between TLCD2 and cellular polyunsaturated fatty acid metabolism?

TLCD2 regulates PUFA incorporation into membrane phospholipids:

  • Knockdown of TLCD2 increases the abundance of 18:2, 18:3, and 20:5 LCPUFAs in phosphatidylcholines (PCs) .

  • When cells are cultivated with exogenous eicosapentaenoic acid (EPA), TLCD2 knockdown leads to excess accumulation of EPA in PCs and PEs, without affecting TAG storage or EPA uptake .

  • Isotope labeling experiments with 13C-labeled linoleic acid (LA) show that TLCD2 knockdown causes increased incorporation of LA in PCs and PEs within 6 hours of incubation .

How does TLCD2 function relate to membrane fluidity regulation?

TLCD2 regulates membrane fluidity primarily by limiting the incorporation of LCPUFAs into membrane phospholipids:

  • LCPUFAs are potent membrane fluidizers - as little as 1 μM of EPA or docosahexaenoic acid (DHA) can prevent membrane rigidification caused by 400 μM palmitic acid .

  • By limiting LCPUFA incorporation into membrane phospholipids, TLCD2 influences the fluidity properties of cellular membranes .

  • TLCD2 knockdown can protect against membrane rigidity phenotypes caused by deficiencies in other membrane homeostasis regulators, such as AdipoR2 .

What is the role of TLCD2 in mitochondrial membrane composition?

TLCD2 has been found to interact with mitochondria and regulate mitochondrial PE composition:

  • Proteomic analysis of TLCD1/2 interactomes revealed enrichment for mitochondrial proteins, suggesting functional interaction with these organelles .

  • In Tlcd1/2 double-knockout mice, mitochondrial PE composition is altered, with decreased MUFA-containing PE species compared to wild-type controls .

  • The interaction with mitochondria appears to be evolutionarily conserved, as the C. elegans homolog FLD-1 shows similar mitochondrial associations .

How does TLCD2 contribute to metabolic disease pathophysiology?

Research has revealed potential roles for TLCD2 in metabolic disease:

  • Tlcd1/2 double-knockout mice display attenuated development of non-alcoholic steatohepatitis (NASH) compared to control mice when fed a Western diet for 30 weeks .

  • These mice exhibit reduced liver size, hepatic inflammation, fibrosis, and serum triglycerides compared to wild-type controls, despite comparable body composition and glucose tolerance .

  • The protective effect against NASH development may be related to alterations in mitochondrial PE composition, which influences cellular metabolism and inflammatory responses .

What is known about lnc-TLCD2-1 and its role in cancer biology?

A long non-coding RNA associated with TLCD2 (lnc-TLCD2-1) has been implicated in cancer biology:

  • lnc-TLCD2-1 can induce radiation resistance in colorectal cancer (CRC) .

  • The mechanism appears to involve regulation of YY1/NF-κB-p65 by targeting miR-193a-5p .

  • lnc-TLCD2-1 promotes proliferation of CRC cells, and patients with high expression of lnc-TLCD2-1 have shorter survival times .

  • This suggests lnc-TLCD2-1 could serve as a potential biomarker for CRC prognosis and as a therapeutic target for radiation-resistant CRC .

How is TLCD2 function conserved between C. elegans and mammals?

TLCD2 function shows remarkable evolutionary conservation:

  • The C. elegans homolog FLD-1 and mammalian TLCD1/2 both regulate membrane fluidity by limiting PUFA-containing phospholipid levels .

  • Both FLD-1 mutations in C. elegans and TLCD2 knockdown in human cells suppress membrane rigidity phenotypes caused by deficiencies in other membrane homeostasis regulators .

  • The subcellular localization to the plasma membrane (rather than ER) is conserved between FLD-1 and TLCD1/2 .

  • Proteomic analyses reveal that both C. elegans FLD-1 and human TLCD1/2 interact with mitochondrial proteins, suggesting evolutionary conservation of this functional interaction .

What distinguishes TLCD2 from other TLC domain-containing proteins?

TLCD2 has several distinguishing features compared to other TLC domain-containing proteins:

  • Unlike ceramide synthases (CERSs) and translocation associated membrane proteins (TRAMs), TLCD2 localizes to the plasma membrane rather than the endoplasmic reticulum .

  • TLCD2 lacks critical motifs found in CERSs and TRAMs, indicating it is neither a ceramide synthase nor a translocation associated protein .

  • TLCD2's function in regulating phospholipid fatty acid composition is distinct from the functions attributed to other TLC domain-containing proteins, which are suggested to act in lipid sensing, transport, or synthesis .

What are the current technical limitations in TLCD2 research?

Several technical challenges persist in TLCD2 research:

  • Lipidomic analyses typically reflect global lipid composition rather than the composition of specific membrane compartments or domains, potentially masking localized effects of TLCD2 .

  • When interpreting lipid supplementation experiments, researchers must exercise caution as uptake, metabolism, incorporation, subcellular localization, and turnover of different lipid species may vary substantially .

  • The exact molecular mechanism by which TLCD2 limits LCPUFA incorporation into phospholipids remains to be fully elucidated, requiring more sophisticated biochemical approaches .

What are promising future research directions for TLCD2?

Based on current findings, several promising research directions emerge:

  • Investigation of TLCD2's potential role in regulating the Lands cycle, through which phospholipids are actively remodeled by fatty acid exchange .

  • Further exploration of TLCD2's interaction with mitochondria and its implications for mitochondrial function and metabolic disease .

  • Detailed structural studies to understand how TLCD2 influences substrate selection by phospholipases or lysophospholipid acyltransferases .

  • Examination of potential roles for TLCD2 in oxidative stress responses, given that FLD-1 mutants in C. elegans show enhanced oxidative stress responses when challenged with LCPUFA .

  • Investigation of TLCD2's potential contributions to other membrane-dependent processes, such as calcium channel activity, insulin secretion, glucose transport, endocytosis, and TRPV channel activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.