Recombinant Human TM2 domain-containing protein 1 (TM2D1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human TM2 Domain-Containing Protein 1 (TM2D1) is a protein containing a structural module related to the G protein-coupled receptor superfamily, characterized by seven transmembrane domains, and capable of binding to β-amyloid protein . TM2D1 has attracted interest due to its potential roles in both neurodegenerative diseases and cancer, particularly hepatocellular carcinoma (HCC) . Its involvement in these seemingly disparate conditions has spurred research into its function, regulation, and therapeutic potential .

Gene and Protein Structure

The TM2D1 gene in humans encodes a protein that contains a TM2 domain . TM2D1 is located on chromosome 8q22.1, with similarities to the G protein-coupled receptor superfamily .

Expression and Localization

TM2D1 mRNA and protein are over-expressed in HCC cell lines compared to non-neoplastic hepatic cell lines . Clinical data indicates that TM2D1 mRNA expression is higher in tumor tissues than in adjacent non-tumor tissues in a significant number of HCC patients .

Role in Hepatocellular Carcinoma (HCC)

The following tables summarize the statistical relationships between TM2D1 expression and clinicopathological features, as well as the prognostic significance of TM2D1 in HCC.

Table 1: Correlation Between TM2D1 Expression and Clinicopathological Features in HCC Patients

ParametersTM2D1 Low (n = 109)TM2D1 High (n = 86)P Value
Sex
Male91770.225
Female189
Age
< 5052320.142
≥ 505754
HBsAg
Negative20190.516
Positive8967
Tumor Number0.088
Single9668
Multiple1318
Tumor Size (cm)0.005
< 57643
≥ 53343
AFP (ng/ml)0.864
< 4007155
≥ 4003831
Microvascular Invasion< 0.001
Absent9250
Present1736
Edmondson Stage

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
TM2D1; BBP; TM2 domain-containing protein 1; Amyloid-beta-binding protein; hBBP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
38-207
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TM2D1
Target Protein Sequence
TSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNE THFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFC GIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP
Uniprot No.

Target Background

Function
May participate in amyloid-beta-induced apoptosis through interaction with beta-APP42.
Gene References Into Functions
  1. sAPP enhanced keratinocyte migration and directional persistence, appearing to synergize with fibronectin in its motogenic effects. PMID: 12553667
  2. Voltage-clamp analysis indicates that BBP does not directly couple to Gαi/o, Gαs, or Gαq proteins, suggesting a requirement for additional components beyond amyloid precursor protein to exert its Aβ-mediated toxic effects. PMID: 12836168
Database Links

HGNC: 24142

OMIM: 610080

KEGG: hsa:83941

STRING: 9606.ENSP00000360222

UniGene: Hs.656790

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

How does TM2D1 interact with β-amyloid peptides in neurological research contexts?

TM2D1 functions as a β-amyloid peptide-binding protein (also known as BBP) that may participate in β-amyloid-induced apoptosis through interaction with beta-APP42 . Methodologically, researchers examining this interaction typically employ co-immunoprecipitation assays combined with either Western blotting or mass spectrometry to confirm direct binding between TM2D1 and β-amyloid peptides.

The protein's potential role in mediating cellular vulnerability to β-amyloid toxicity occurs through G protein-regulated programs of cell death . To investigate this mechanism, researchers commonly use two-electrode voltage-clamp techniques to determine that BBP (TM2D1) is not directly coupled to Gα(i/o), Gα(s), or Gα(q) proteins, suggesting TM2D1 may require components beyond amyloid precursor protein to exert its toxic effects .

What are the recommended protocols for handling recombinant TM2D1 protein in laboratory settings?

Recombinant TM2D1 should be stored at -20°C for regular storage, or at -80°C for extended preservation. Working aliquots can be maintained at 4°C for up to one week . When handling recombinant TM2D1, researchers should note that small volumes may occasionally become entrapped in the seal of product vials during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container's cap .

For experimental applications, recombinant TM2D1 with ≥85% purity (as determined by SDS-PAGE) is typically supplied in liquid form containing glycerol . When designing experiments, researchers should account for the host cell system (free expression system for many commercial preparations) and consider the potential influence of any tags or fusion partners on protein activity.

How does the TM2D family contribute to Notch signaling and neuronal function?

TM2D family proteins, including TM2D1, play crucial roles in Notch signaling, which has significant implications for neuronal development and function. Research in Drosophila demonstrates that knockout of TM2D genes results in maternal-effect neurogenic defects . When investigating Notch signaling involvement:

  • Evaluate Notch target gene expression through quantitative PCR or reporter assays when TM2D1 is manipulated

  • Assess neurogenic phenotypes using immunohistochemistry for neuronal markers in TM2D knockout models

  • Perform epistasis experiments by manipulating both TM2D and Notch pathway components

The most conserved regions of TM2D proteins act as potent inhibitors of Notch signaling specifically at the γ-secretase cleavage step . Notably, the functional relationship between TM2D proteins and Notch signaling provides insight into potential neurodegenerative mechanisms, as the γ-secretase complex (which includes Presenilin proteins PSEN1 and PSEN2) is involved in both Notch signaling and amyloid precursor protein (APP) processing in Alzheimer's disease .

What experimental approaches are most effective for studying TM2D1's role in age-dependent neurological phenotypes?

To effectively investigate TM2D1's role in age-dependent neurological phenotypes, researchers should employ a multi-faceted approach:

  • Lifespan analysis: TM2D3 mutant flies display shortened lifespans and age-dependent motor defects, suggesting a similar approach for TM2D1

  • Electrophysiological assessments: Perform progressive electrophysiological evaluations to detect functional neuronal changes that may not be apparent morphologically

  • Behavioral testing: Implement age-dependent behavioral assays to assess motor function and cognition across the lifespan of model organisms with TM2D1 manipulation

  • Genetic rescue experiments: Test whether wild-type human TM2D1 can rescue phenotypes in animal models, as demonstrated with TM2D3 where human TM2D3 rescued fly amx mutant phenotypes but the P155L variant failed to do so

  • Triple knockout models: Generate combined knockout models of all three TM2D family genes to assess redundancy and cooperative functions, as single and triple knockouts in Drosophila show similar phenotypes

What is the relationship between TM2D1 and γ-secretase function in Alzheimer's disease models?

TM2D1's relationship with γ-secretase function represents a critical intersection between Notch signaling and Alzheimer's disease pathogenesis. γ-secretase is a membrane-bound intramembrane protease complex with catalytic subunits encoded by PSEN1 and PSEN2 genes . This complex processes multiple type-I transmembrane proteins, including both APP and Notch receptors .

When investigating this relationship, researchers should:

  • Assess γ-secretase activity in the presence and absence of TM2D1 using fluorogenic substrate assays

  • Measure the levels of γ-secretase cleavage products (like AICD from APP or NICD from Notch) through Western blotting

  • Evaluate direct interactions between TM2D1 and γ-secretase complex components through co-immunoprecipitation or proximity ligation assays

  • Test whether TM2D1 overexpression affects γ-secretase substrate specificity (APP versus Notch)

The observation that overexpression of the most conserved region of TM2D proteins inhibits Notch signaling specifically at the γ-secretase cleavage step suggests TM2D1 may modulate γ-secretase activity in ways relevant to both neurodevelopment and neurodegeneration.

How does TM2D1 contribute to epithelial-mesenchymal transition in hepatocellular carcinoma?

TM2D1 plays a significant role in promoting epithelial-mesenchymal transition (EMT) in hepatocellular carcinoma (HCC). Mechanistically, TM2D1 activates the AKT and β-catenin signaling pathways, leading to changes in molecular markers associated with EMT .

To investigate TM2D1's role in EMT:

  • Compare TM2D1 expression levels between HCC cell lines and non-neoplastic hepatic cell lines (like L02) using both mRNA (qPCR) and protein (Western blot) analyses

  • Evaluate the effects of TM2D1 overexpression or knockdown on cell proliferation, migration, and invasion using functional assays

  • Assess changes in EMT markers (E-cadherin, N-cadherin, vimentin) following TM2D1 manipulation

  • Measure AKT and β-catenin activation states (phosphorylation, nuclear localization) in response to TM2D1 expression changes

Studies have found that all tested HCC cell lines overexpress both mRNA and protein levels of TM2D1 compared to non-neoplastic hepatic cell lines, with 70% of HCC tumors showing higher TM2D1 mRNA levels than adjacent peritumoral tissues .

What is the prognostic significance of TM2D1 expression in hepatocellular carcinoma?

TM2D1 expression has significant prognostic value in HCC patients. High TM2D1 expression correlates with:

ParametersTM2D1 expressionP value
Low (n = 109)High (n = 86)
Tumor size (cm)
< 57643
≥ 53343
Microvascular invasion
Absent9250
Present1736

For clinical applications, researchers should employ tissue microarray (TMA) construction and immunohistochemistry (IHC) to evaluate TM2D1 expression levels in patient samples, followed by Kaplan-Meier survival analysis and Cox regression to determine prognostic significance.

What methodological approaches can identify TM2D1-regulated downstream targets in cancer pathways?

To identify TM2D1-regulated downstream targets in cancer pathways, researchers should employ several complementary approaches:

  • Transcriptomic profiling: Perform RNA-sequencing on cells with TM2D1 overexpression or knockdown to identify differentially expressed genes

  • Phosphoproteomic analysis: Use mass spectrometry-based phosphoproteomics to identify changes in phosphorylation states of proteins in AKT and β-catenin signaling pathways following TM2D1 manipulation

  • ChIP-seq analysis: For β-catenin targets, chromatin immunoprecipitation followed by sequencing can identify direct transcriptional targets affected by TM2D1-induced β-catenin activation

  • Pathway analysis: Employ inhibitors of AKT (e.g., MK-2206) or β-catenin (e.g., XAV939) to determine whether TM2D1's effects on cell proliferation, migration, and invasion are dependent on these pathways

  • Co-expression network analysis: Analyze publicly available HCC datasets to identify genes that consistently co-express with TM2D1, suggesting functional relationships

Research has established that TM2D1 promotes hyper-activation of Akt and β-catenin, corresponding with molecular marker changes in EMT signaling pathways . These methodological approaches can further elucidate the specific downstream targets mediating TM2D1's oncogenic effects.

How do the functions of TM2D family proteins (TM2D1, TM2D2, TM2D3) compare across different experimental models?

The TM2D family proteins show remarkable functional conservation across experimental models. In Drosophila, knockouts of all three TM2D genes (almondex/TM2D3, amaretto/TM2D1, and biscotti/TM2D2) share the same maternal-effect neurogenic defect . Importantly, triple null animals do not exhibit phenotypes worse than single nulls, suggesting these genes function together .

When comparing TM2D family functions across models:

  • Conduct phylogenetic analysis to establish evolutionary relationships between TM2D family members

  • Perform cross-species rescue experiments to test functional conservation

  • Compare tissue expression patterns across species using RNA-seq or in situ hybridization

  • Assess binding partners through co-immunoprecipitation coupled with mass spectrometry

The evolutionary conservation of TM2D family functions suggests research findings in model organisms like Drosophila are likely relevant to human disease contexts. The ability of human TM2D3 to rescue fly amx mutant phenotypes demonstrates this functional conservation .

What is the significance of the connection between TM2D1's roles in neurodegeneration and cancer?

The dual involvement of TM2D1 in both neurodegeneration and cancer represents an intriguing biological paradox with significant research implications. Epidemiological studies have shown a correlation between Alzheimer's disease and low incidence of cancer, though the underlying mechanisms remain elusive .

To investigate this connection:

  • Compare TM2D1 expression levels between neurodegeneration models and cancer models

  • Identify common binding partners and signaling pathways affected by TM2D1 in both contexts

  • Evaluate whether TM2D1 variants associated with neurodegeneration affect cancer-related phenotypes and vice versa

  • Examine age-dependent changes in TM2D1 function that might explain its dual roles

The significant overlap in biological pathways affected by TM2D1—including Notch signaling, which is implicated in both neuronal function and cancer progression—provides a molecular framework for understanding this connection. The γ-secretase complex processes both Notch receptors and APP, linking neurodegenerative and cancer-related processes at a fundamental mechanistic level .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.