Recombinant Human TM2 domain-containing protein 2 (TM2D2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human TM2 Domain-Containing Protein 2 (TM2D2)

Recombinant Human TM2 Domain-Containing Protein 2 (TM2D2) is a protein that in humans is encoded by the TM2D2 gene . The TM2D2 protein contains a structural module related to the seven transmembrane domain G protein-coupled receptor superfamily . TM2D proteins are conserved in metazoans and are encoded by three separate genes in each model organism species that has been sequenced .

Gene and Protein Structure

The TM2D2 gene is present in humans . All TM2D proteins have a predicted N-terminal signal sequence and two transmembrane domains that are connected through a short intracellular loop . Within this loop, there is an evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif, a sequence found in some G-protein coupled receptors that mediates their conformational change upon ligand binding . The sequences of the two transmembrane domains, as well as the intracellular loop, are highly conserved throughout evolution and between the three TM2 domain-containing proteins .

Function and Significance

Although the in vivo functions of many of these genes have not been well defined , TM2D proteins regulate Notch signaling and neuronal function . Studies have explored the function of TM2D3 and two closely related genes, TM2D1 and TM2D2, using the fruit fly Drosophila melanogaster .
Knockout models in Drosophila have shown that TM2D1 and TM2D2 mutations phenotypically mimic the loss of TM2D3 .

TM2D2 and Alzheimer's Disease

TM2D3 is associated with Alzheimer’s disease (AD), and its fly ortholog almondex is required for embryonic Notch signaling . The functional links between all three TM2D genes are likely evolutionarily conserved, suggesting that this entire gene family may be involved in AD .

Availability of Recombinant Human TM2D2

Recombinant Human TM2 domain-containing protein 2 (TM2D2) is available for purchase from various sources, with different options for the source organism, including Yeast, E. coli, Baculovirus, and Mammalian cells .

Data table

FeatureDescription
Gene ID83877
Protein DomainsTwo transmembrane domains, intracellular DRF motif
Related SuperfamilySeven transmembrane domain G protein-coupled receptor superfamily
FunctionRegulation of Notch signaling and neuronal function
Associated DiseasesAlzheimer's Disease (AD)
Model Organism StudiesDrosophila melanogaster
ExpressionFor detailed expression data, refer to the Rat Genome Database
Available SourcesYeast, E. coli, Baculovirus, Mammalian cell
ConservationConserved in metazoans
MotifsDRF (aspartate-arginine-phenylalanine) motif
PurificationHigh purity
ModificationsAvi-tag Biotinylated: E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks if needed. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TM2D2; BLP1; TM2 domain-containing protein 2; Beta-amyloid-binding protein-like protein 1; BBP-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-214
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TM2D2
Target Protein Sequence
QNATAEPELTSAGAAQPEGPGGAASWEYGDPHSPVILCSYLPDEFIECEDPVDHVGNATA SQELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYTGHYFITTLL YSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDGSNWCTVY
Uniprot No.

Target Background

Database Links

HGNC: 24127

OMIM: 610081

KEGG: hsa:83877

UniGene: Hs.7471

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the basic structure of TM2D2 and how does it compare to other TM2D family proteins?

TM2D2 is one of three highly conserved TM2 domain-containing proteins encoded in the human genome. The protein structure includes:

  • N-terminal signal sequence

  • Two transmembrane domains connected through a short intracellular loop

  • An evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif within this loop

  • A divergent extracellular region between the signal sequence and first transmembrane domain

  • A short C-terminal extracellular tail that varies among the three TM2D proteins

The two transmembrane domains and the intracellular loop sequence are highly conserved throughout evolution and between the three TM2D proteins, while the extracellular regions show greater variation . TM2D2 has a shorter C-terminal tail compared to TM2D1 but similar to TM2D3 .

What are the molecular functions of the conserved domains in TM2D2?

The molecular functions of the conserved domains remain largely unknown and represent an active area of investigation . The DRF motif in the intracellular loop is particularly interesting as this sequence is found in some G-protein coupled receptors where it mediates conformational changes upon ligand binding . This suggests that TM2D2 may undergo similar structural changes during signaling processes. The high conservation of the transmembrane domains indicates their structural importance, likely for proper membrane insertion and protein stability .

What are the best experimental models for studying TM2D2 function?

Drosophila melanogaster has emerged as a powerful model system for studying TM2D gene function due to the conservation of these genes across species and the availability of genetic tools. Using CRISPR/Cas9-mediated homology directed repair (HDR), researchers have successfully generated null alleles for CG11103 (the Drosophila ortholog of TM2D2) .

For experimental design:

  • Generate clean knockout lines using CRISPR/Cas9

  • Insert dominant markers (e.g., body color markers) to track the knockout alleles

  • Confirm transcript loss through RT-PCR

  • Assess phenotypes at multiple developmental stages

  • Generate double and triple knockouts to test functional redundancy

This approach allows for comprehensive functional characterization while controlling for genetic background effects that might confound the interpretation of results.

How can I validate the expression and function of recombinant TM2D2 in experimental systems?

A systematic validation approach should include:

  • Expression verification: Western blotting using antibodies against the native protein or protein tags (e.g., HA tag, GST tag)

  • Localization studies: Immunofluorescence or confocal microscopy to confirm proper subcellular localization to membrane compartments

  • Functional assays: Notch signaling reporter assays measuring transcriptional output

  • Rescue experiments: Testing if the recombinant protein can rescue phenotypes in knockout models

  • Interaction studies: Co-immunoprecipitation to verify known protein interactions

For recombinant protein production, expression in wheat germ, E. coli, or mammalian cell systems has been successfully employed for TM2D family proteins, with purities >90% achievable through appropriate tags and purification methods .

How does TM2D2 integrate into the Notch signaling pathway?

TM2D2, like other TM2D family proteins, appears to function at or near the γ-secretase cleavage step of Notch activation . The current model suggests:

  • Notch signaling is initiated by binding of the Notch receptor to its ligands (Delta or Serrate in Drosophila)

  • This binding triggers a series of proteolytic cleavages, culminating in γ-secretase-mediated release of the Notch intracellular domain (NICD)

  • TM2D2 likely functions as a positive modulator of this γ-secretase cleavage event

The evidence for this role comes primarily from genetic epistasis experiments and the observation that TM2D gene knockouts exhibit maternal-effect neurogenic phenotypes characteristic of Notch signaling defects .

What experimental approaches can detect alterations in Notch signaling due to TM2D2 manipulation?

Experimental ApproachApplicationReadoutAdvantagesLimitations
Embryonic neurogenic phenotypingIn vivo functionHypertrophy of neural tissueDirect physiological relevanceMaternal effects may complicate interpretation
Notch reporter assaysCell-based functionLuciferase/GFP expressionQuantitative, high-throughputMay miss context-dependent effects
Western blot for NICDMolecular mechanismNICD protein levelsDirect measure of Notch processingDoes not address downstream effects
qRT-PCR for Notch targetsDownstream effectsTarget gene expressionComprehensive pathway activityIndirect measure of TM2D2 activity
Co-immunoprecipitationProtein interactionsPhysical association with γ-secretaseDirect evidence of mechanismMay not reflect in vivo dynamics

What evidence links TM2D2 to Alzheimer's disease pathogenesis?

While TM2D3 has been directly linked to Late-Onset Alzheimer's Disease (LOAD) through an exome-wide association study (OR = 7.45, pMETA = 6.6x10^-9), the evidence for TM2D2's involvement is more indirect but compelling :

  • TM2D2 shares structural similarity with TM2D3, suggesting functional overlap

  • TM2D2 (also known as BBP-like protein 1) was identified in a yeast two-hybrid screen as a protein that binds to Aβ42

  • Further studies showed TM2D2 can interact with both Aβ42 and Aβ40

  • Preliminary data suggested it may also interact with APP (amyloid precursor protein)

  • The shared function of TM2D family proteins in Notch signaling, which involves γ-secretase (also crucial for APP processing in AD), provides a mechanistic link

These multiple lines of evidence suggest that all three TM2D family genes may be involved in AD pathogenesis, warranting further investigation through human genetics studies .

How can researchers design experiments to investigate TM2D2's role in Alzheimer's disease models?

A comprehensive experimental approach should include:

  • Cell-based models:

    • Overexpression and knockdown of TM2D2 in neuronal cell lines

    • Assessment of APP processing and Aβ production

    • Measurement of sensitivity to Aβ-induced cell death

  • Animal models:

    • Generation of conditional TM2D2 knockout mice

    • Crossing with AD mouse models (e.g., APP/PS1)

    • Analysis of amyloid pathology, neuronal function, and cognitive performance

  • Human genetics:

    • Targeted sequencing of TM2D2 in AD cohorts

    • Assessment of rare and common variants

    • Functional characterization of identified variants

  • Biochemical studies:

    • Characterization of TM2D2-Aβ binding mechanisms

    • Investigation of interactions with γ-secretase components

    • Structural studies of the DRF motif and its role in potential conformational changes

This multi-faceted approach would help establish causality and elucidate the specific mechanisms through which TM2D2 might influence AD pathogenesis.

How do the three TM2D family proteins functionally interact or compensate for each other?

Studies in Drosophila have shown that single knockouts of each TM2D family gene (TM2D1, TM2D2, and TM2D3 orthologs) display similar maternal-effect neurogenic phenotypes . Intriguingly, the triple knockout of all three genes shows the same phenotype as the single knockouts, suggesting these genes function together rather than redundantly .

To investigate potential compensation mechanisms:

  • Generate combinatorial knockout models (single, double, and triple) in relevant systems

  • Perform transcriptomic analysis to detect compensatory gene expression changes

  • Use protein interaction studies to determine if TM2D proteins form complexes

  • Conduct domain-swapping experiments to identify functionally equivalent regions

  • Apply quantitative phenotyping to detect subtle differences between single and multiple knockouts

Understanding these functional interactions may reveal why disruption of any single TM2D protein can cause similar phenotypic effects despite their evolutionary divergence.

What is the significance of the DRF motif in TM2D2's function and potential as a therapeutic target?

The conserved DRF (aspartate-arginine-phenylalanine) motif is found in the intracellular loop of all TM2D proteins and is also present in some G-protein coupled receptors where it mediates conformational changes upon ligand binding . Research has suggested the DRF motif is required for TM2D1's ability to mediate Aβ-toxicity, though one study refuted the hypothesis that TM2D1 couples to G proteins .

To explore the DRF motif's significance:

  • Perform site-directed mutagenesis of the DRF residues

  • Assess effects on protein conformation using structural techniques

  • Measure impact on Notch signaling and Aβ interaction

  • Conduct in silico modeling to identify potential small molecule binding pockets

  • Screen for compounds that specifically target the DRF motif or its structural environment

If the DRF motif proves critical for TM2D2's pathological functions but not physiological roles, it could represent a specific therapeutic target for modulating Alzheimer's disease processes without disrupting essential cellular functions .

How can contradictory data in TM2D2 research be resolved through improved experimental design?

Research on TM2D family proteins has yielded some apparently contradictory results. For example, while Kajkowski et al. proposed that TM2D1 functions as a transmembrane receptor mediating Aβ-toxicity, Lee et al. refuted this by providing data that TM2D1 is not coupled to G proteins .

To resolve such contradictions:

  • Control for experimental variables:

    • Use consistent cell types, expression levels, and assay conditions

    • Implement rigorous controls for antibody specificity

    • Validate key reagents independently

  • Improve statistical approach:

    • Increase sample sizes based on power calculations

    • Apply appropriate statistical tests considering data distribution

    • Control for multiple comparisons when screening multiple conditions

  • Integrate multiple methodologies:

    • Combine biochemical, genetic, and imaging approaches

    • Use both gain-of-function and loss-of-function strategies

    • Validate in multiple model systems

  • Consider context-dependency:

    • Test hypotheses under various physiological conditions

    • Examine developmental stage-specific effects

    • Assess cell-type specific responses

By implementing these rigorous experimental design principles, researchers can more confidently resolve contradictions and advance our understanding of TM2D2 biology.

What genomic and proteomic approaches could advance our understanding of TM2D2 function?

Next-generation methodologies offer powerful tools for comprehensive characterization of TM2D2:

  • CRISPR-based screens:

    • Genome-wide screens for genetic interactors

    • CRISPRi/CRISPRa for tunable expression modulation

    • Base editing for systematic structure-function studies

  • Proteomics approaches:

    • BioID or APEX proximity labeling to map protein neighborhoods

    • Quantitative interaction proteomics under various conditions

    • Post-translational modification mapping

  • Single-cell technologies:

    • scRNA-seq to identify cell populations sensitive to TM2D2 disruption

    • Spatial transcriptomics to map expression in complex tissues

    • Multi-omics integration for comprehensive characterization

These approaches could help identify novel functions, interaction partners, and regulatory mechanisms that have been missed by traditional biochemical and genetic methods.

How might recombinant TM2D2 be used as a tool for drug discovery in Alzheimer's disease research?

Recombinant TM2D2 could serve as a valuable tool in drug discovery pipelines:

  • High-throughput screening platforms:

    • Develop binding assays for TM2D2-Aβ interaction

    • Design split-reporter systems for monitoring conformational changes

    • Establish cellular assays measuring TM2D2's effect on γ-secretase activity

  • Structure-based drug design:

    • Solve the crystal structure of TM2D2 alone and in complex with binding partners

    • Identify druggable pockets, particularly around the DRF motif

    • Conduct in silico screening followed by biochemical validation

  • Functional validation:

    • Test compound effects on TM2D2-dependent Notch signaling

    • Assess impact on Aβ production and toxicity

    • Validate in increasingly complex models from cells to organisms

The development of such tools could accelerate the identification of compounds that specifically modulate TM2D2 function, potentially leading to novel therapeutic approaches for Alzheimer's disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.