Recombinant Human TM2 domain-containing protein 3 (TM2D3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human TM2D3

Recombinant Human TM2 domain-containing protein 3 (TM2D3) is a protein encoded by the TM2D3 gene, located on chromosome 15q26 . TM2D3 is one of three highly conserved TM2 domain-containing proteins in humans . The other two proteins, TM2D1 and TM2D2, share a similar protein domain structure with TM2D3 .

Structure and Function

All TM2D proteins have a predicted N-terminal signal sequence and two transmembrane domains connected through a short intracellular loop . Within this loop, there is an evolutionarily conserved aspartate-arginine-phenylalanine (DRF) motif, a sequence found in some G-protein coupled receptors that mediates their conformational change upon ligand binding . The sequences of the two transmembrane domains and the intracellular loop are highly conserved throughout evolution and between the three TM2 domain-containing proteins . The three proteins also have short C-terminal extracellular tails that are evolutionarily conserved but vary among the three proteins .

The molecular functions of these conserved and non-conserved domains of TM2D proteins are unknown . Research indicates that TM2D3 may activate Notch1 and physically interact with it . TM2D3 shares homology with the β-amyloid peptide-binding protein (BBP or TM2D1) .

Association with Alzheimer's Disease

Rare variants in TM2D3 are associated with Alzheimer's disease (AD) . One such variant, rs139709573, also known as P155L, is associated with late-onset AD . The TM2D3 variant was enriched nearly 10-fold in the Icelandic AGES cohort (0.45% MAF) . The rs139709573 was significantly associated with late-onset AD when the analysis was restricted to the AGES-discovery sample (143 cases, 2374 controls) .

Table 1: Sample characteristics and association results for P155L (rs139709573) in TM2D3 in the two Icelandic AGES cohorts

CohortGroupNo (% women)Age, mean (SD), yearAPOE ε4+ No (%)TM2D3 carriers, No (%)p (OR, 95% CI) ap Fisher’s Exact bp conditional c
AGES-discoveryCases143 (59)82.5 (4.9)66 (46)7 (4.9)5.9x10-8 (8.62, 3.43–21.68)5.6x10-48.4x10-8
Controls2374 (59)78.9 (5.0)638 (27)20 (0.8)
AGES-followupCases290 (59)84.5 (5.1)127 (44)6 (2.1)3.0x10-3 (5.42, 1.60–18.32)6.2x10-31.1x10-2
Controls1529 (57)77.6 (5.2)375 (25)7 (0.5)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TM2D3; BLP2; TM2 domain-containing protein 3; Beta-amyloid-binding protein-like protein 2; BBP-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-247
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
GEQSQALAQSIKDPGPTRTFTVVPRAAESTEIPPYVMKCPSNGLCSRLPADCIDCTTNFS CTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSC PRQRYPANCTVRDHVHCLGNRTFPKMLYCNWTGGYKWSTALALSITLGGFGADRFYLGQW REGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI
Uniprot No.

Target Background

Gene References Into Functions
  1. Our findings associate a rare TM2D3 variant with late-onset Alzheimer's disease susceptibility, potentially linking it to the beta-amyloid cascade (PMID: 27764101).
  2. Our analysis identified 26 candidate genes with differential expression between osteoarthritis patients and controls. BLP2 and CIAS1 appear to be trans-regulated, as indicated by the absence of allelic expression imbalances (PMID: 16642435).
Database Links

HGNC: 24128

OMIM: 610014

KEGG: hsa:80213

STRING: 9606.ENSP00000330433

UniGene: Hs.288912

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the basic structure and evolutionary conservation of TM2D3?

TM2D3 is one of three highly conserved TM2 domain-containing proteins encoded in the human genome. All TM2D proteins share a similar domain structure consisting of a predicted N-terminal signal sequence and two transmembrane domains connected through a short intracellular loop. Within this loop lies an evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif, a sequence found in some G-protein coupled receptors that mediates conformational changes upon ligand binding .

The extracellular region between the signal sequence and first transmembrane domain shows divergence across species and among the three TM2D proteins. In contrast, the sequences of the two transmembrane domains and the intracellular loop are highly conserved throughout evolution. TM2D proteins also possess short C-terminal extracellular tails that show evolutionary conservation but vary among the three proteins; notably, TM2D1 has a slightly longer C-terminal tail than TM2D2 and TM2D3 .

How is TM2D3 related to other members of the TM2D family?

TM2D3 belongs to a family that includes TM2D1 and TM2D2, with each protein encoded by a highly conserved orthologous gene in Drosophila melanogaster. In Drosophila, these genes are almondex (amx, ortholog of TM2D3), amaretto (amrt, ortholog of TM2D2), and biscotti (bisc, ortholog of TM2D1) .

Experimental evidence from knockout studies in Drosophila suggests these three genes function together. Knockout of any individual TM2D gene results in a similar maternal-effect neurogenic phenotype, and the triple knockout is phenotypically similar to single gene knockouts, indicating these proteins may function as a unit rather than in redundant pathways .

High-throughput proteomics data based on co-immunoprecipitation mass spectrometry from human cells has detected physical interactions between TM2D1-TM2D3 and TM2D2-TM2D3, further supporting the hypothesis that these proteins may form a functional complex .

What is known about TM2D3's association with Alzheimer's disease?

A rare variant in TM2D3 (P155L) has been significantly associated with increased risk of developing late-onset Alzheimer's disease (LOAD) through exome-wide association analysis. This variant shows an odds ratio of 7.5 (95% CI = 3.5-15.9, p = 6.6×10^-9) and is particularly enriched in Icelanders (~0.5% versus <0.05% in other European populations) .

The P155L variant is also associated with earlier age-at-onset of LOAD. Functional studies have established P155L as a damaging allele by demonstrating that while human TM2D3 can rescue phenotypes caused by mutation in the Drosophila ortholog almondex, this rescue activity is abolished by the P155L mutation .

These findings suggest possible links between TM2D3 and the β-amyloid cascade, a central pathway in Alzheimer's disease pathogenesis, though the exact molecular mechanisms require further investigation .

How do experimental models inform our understanding of TM2D3 function in neurodegeneration?

Drosophila melanogaster has proven to be a valuable model organism for studying TM2D3 function. The amx gene (Drosophila ortholog of TM2D3) knockout exhibits age-dependent neurological phenotypes that provide insights into potential mechanisms of neurodegeneration.

Specifically, amx null flies demonstrate significantly shortened lifespan compared to control animals (median lifespan of 27 days versus 51 days in controls, p=1.0×10^-11). This phenotype can be partially rescued by introducing human TM2D3 into the amx null background, resulting in a median lifespan of 33 days, which represents a weak but significant suppression (p=9.5×10^-10) .

Electrophysiological studies reveal progressive neuronal dysfunction in amx mutants. Young mutant flies (5 days post-eclosion) show minor failure rates in giant fiber-mediated responses at high frequency stimulation (100 Hz). As flies age, these defects become more severe, with significant increases in failure rates at both moderate (50 Hz) and high (100 Hz) stimulation frequencies by 25 days post-eclosion. Remarkably, human TM2D3 can fully rescue these electrophysiological defects, indicating an evolutionarily conserved role of this gene in maintaining neuronal function during aging .

What molecular mechanisms link TM2D3 to Notch signaling and Alzheimer's disease pathways?

Experimental evidence suggests TM2D3 functions in the Notch signaling pathway, which is intriguing given that Presenilin, the catalytic component of γ-secretase involved in both Notch signaling and amyloid precursor protein (APP) processing, is a central player in Alzheimer's disease pathogenesis.

Overexpression of the most conserved region of TM2D proteins acts as a potent inhibitor of Notch signaling specifically at the γ-secretase cleavage step . This finding is particularly significant because γ-secretase also cleaves APP to generate Aβ peptides implicated in Alzheimer's disease.

The embryonic neurogenic phenotype observed in TM2D gene knockouts is a rare phenotype almost exclusively associated with genes affecting Notch signaling . Mutations in the Drosophila TM2D3 homolog, almondex, cause phenotypes similar to loss of Notch/Presenilin signaling, further supporting this connection .

These observations suggest a potential mechanistic link between TM2D3, Notch signaling, and Alzheimer's disease pathways, possibly converging on γ-secretase function, though detailed molecular interactions remain to be fully elucidated.

What is the functional significance of the P155L variant in TM2D3?

The P155L variant of TM2D3 represents a rare but impactful genetic risk factor for late-onset Alzheimer's disease. Although this missense variant was not predicted to be pathogenic based on multiple variant pathogenicity prediction algorithms (including SIFT, PolyPhen, and CADD), experimental testing has established its functional significance .

Using a Drosophila embryo-based assay, researchers demonstrated that the P155L variant has deleterious consequences on TM2D3 function. While wild-type human TM2D3 can rescue phenotypes caused by mutation in the Drosophila ortholog almondex, this rescue activity is abolished by the P155L mutation .

This functional validation is particularly important because it demonstrates how experimental approaches can reveal pathogenicity that computational prediction methods may miss. The substantial odds ratio (7.5) associated with this variant suggests it has a large effect on disease risk, making it an important target for understanding disease mechanisms and potentially developing personalized therapeutic approaches for carriers.

What approaches are effective for generating and validating TM2D gene knockout models?

Creating knockout models for TM2D genes has been successfully accomplished using CRISPR-Cas9 technology in Drosophila. This approach involves inserting dominant markers (such as yellow for body color or white for eye color) into the endogenous loci to disrupt gene function while simultaneously providing phenotypic markers to track the mutation .

For validation of knockout efficiency, RT-PCR is used to confirm the absence of gene transcripts. Phenotypic validation includes assessment of viability, fertility, and embryonic development. For TM2D genes, all three single knockouts in Drosophila exhibit female sterility and maternal-effect neurogenic phenotypes, which can be rescued by genomic constructs containing the respective wild-type genes .

To generate double or triple knockouts, researchers have used recombination strategies. For example, since amx and amrt are both located on the X-chromosome (at cytological regions 8D2 and 12C4, respectively, approximately 19cM apart), recombination between these loci can be achieved by following dominant markers knocked into each locus .

How can researchers effectively assess TM2D3 function in neuronal health and neurodegeneration?

Multiple complementary approaches can be employed to assess TM2D3's role in neuronal function and neurodegeneration:

  • Lifespan analysis: Comparing survival curves between TM2D3 knockout animals and appropriate controls (e.g., animals rescued with wild-type TM2D3) provides a broad measure of gene impact on organismal health. Statistical methods such as log-rank tests can determine significance of observed differences .

  • Electrophysiological assessment: Giant fiber system recordings in Drosophila allow quantification of neuronal function at different ages. This involves delivering electrical stimuli at different frequencies (20-100 Hz) and recording muscle responses to measure the fidelity of signal transmission. Progressive increases in response failure rates with age indicate neurodegeneration .

  • Rescue experiments: Introducing wild-type or mutant versions of human TM2D3 into model organisms lacking the endogenous gene can reveal functional conservation and the impact of specific variants. This approach has successfully demonstrated both the functional conservation of TM2D3 across species and the damaging nature of the P155L variant .

  • Notch signaling assays: Given TM2D3's involvement in Notch signaling, researchers can assess pathway activity using reporter constructs or by examining expression levels of Notch target genes in various experimental conditions .

What methodologies can reveal interactions between TM2D family proteins?

Understanding the functional relationships between TM2D family members requires specialized approaches:

  • Co-immunoprecipitation and mass spectrometry (co-IP/MS): This technique has successfully identified physical interactions between TM2D1-TM2D3 and TM2D2-TM2D3, suggesting these proteins may form a complex. For these experiments, one TM2D protein is immunoprecipitated using a specific antibody, and interacting proteins are identified by mass spectrometry .

  • Genetic interaction studies: Comparing phenotypes of single, double, and triple knockout models can reveal functional relationships. The observation that triple TM2D gene knockouts in Drosophila are not phenotypically worse than single knockouts suggests these genes function together rather than in parallel or redundant pathways .

  • Functional complementation assays: Testing whether overexpression of one TM2D family member can rescue phenotypes caused by loss of another can indicate functional redundancy or compensatory mechanisms.

  • Fluorescent protein tagging and co-localization: Using epitope tags such as GFP fused to TM2D proteins allows visualization of their subcellular localization and potential co-localization with other family members, providing clues about their functional interactions .

How might TM2D3 serve as a target for Alzheimer's disease therapeutics?

The strong association between the TM2D3 P155L variant and increased Alzheimer's disease risk suggests therapeutic potential in targeting this pathway. Research approaches might include:

  • Small molecule screening: Identifying compounds that can restore function to the P155L variant or enhance wild-type TM2D3 activity could represent a novel therapeutic strategy. The Drosophila rescue assay provides a platform for testing such compounds.

  • Gene therapy approaches: For carriers of the P155L variant, gene therapy to introduce functional TM2D3 could theoretically address the loss of function, though significant challenges remain in delivery methods and safety.

  • Targeting downstream pathways: If further research elucidates the specific molecular mechanisms by which TM2D3 dysfunction contributes to neurodegeneration, intervention at downstream points in the pathway might prove more tractable than directly targeting TM2D3.

The connection between TM2D3 and Notch signaling suggests additional therapeutic possibilities, though care must be taken given the essential roles of Notch in multiple tissues .

What is the significance of TM2D family proteins in phagocytosis research?

All three TM2D genes were identified through a large-scale CRISPR-based screen as novel regulators of phagocytosis. Single knockout of each TM2D gene in a myeloid cell line was sufficient to cause similar phagocytic defects, suggesting these genes function together in this process .

This finding is particularly intriguing given that phagocytosis plays crucial roles in the brain, including clearance of Aβ peptides, synaptic pruning, and removal of dead or damaged cells. Dysfunction in microglial phagocytosis has been implicated in Alzheimer's disease pathogenesis.

Future research directions might include:

  • Characterizing the specific steps of phagocytosis affected by TM2D proteins

  • Investigating substrate specificity, particularly toward Alzheimer's-relevant substrates

  • Exploring whether the P155L variant affects phagocytic functions

  • Developing therapeutic approaches to enhance phagocytosis in TM2D-deficient cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.