Toll-like receptor 10 is a member of the evolutionarily conserved Toll-like receptor family that plays a fundamental role in pathogen recognition and activation of innate immunity. TLR10 is genomically positioned within a locus that also contains TLR1 and TLR6, two receptors known to function as coreceptors for TLR2 . This genomic clustering suggests evolutionary and functional relationships among these receptors. Unlike some other TLRs, TLR10 remained categorized as an "orphan receptor" for many years due to uncertainty regarding its specific ligands and signaling mechanisms. TLR10 exhibits high conservation from Drosophila to humans and shares structural and functional similarities with other TLR family members that recognize pathogen-associated molecular patterns (PAMPs) expressed on infectious agents .
Recombinant Human TLR10 partial protein represents a specific segment of the full-length TLR10 protein. Commercial preparations typically include amino acids 171-269 of the NP_112218.2 sequence . The partial recombinant protein contains the sequence "FLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHT," which corresponds to a region within the extracellular domain of TLR10 . Like other TLRs, the full TLR10 protein is a type I transmembrane glycoprotein with an extracellular domain composed of numerous leucine-rich repeats and an intracellular region containing a Toll IL-1 receptor (TIR) homology domain .
The recombinant partial TLR10 protein is often produced with specific tags to facilitate purification and detection. For instance, commercially available recombinant TLR10 is produced with a GST-tag at the N-terminal . This fusion protein has a calculated molecular weight of approximately 36.52 kDa, which can be verified through 12.5% SDS-PAGE stained with Coomassie Blue .
Research has established that native TLR10 exists as a highly N-glycosylated protein, which may be critical for its appropriate folding, trafficking, and function . While recombinant partial TLR10 produced in wheat germ expression systems may not fully recapitulate all post-translational modifications of the native protein, this characteristic should be considered when interpreting experimental results using such recombinant proteins. The glycosylation pattern of TLR10 may contribute to its ligand recognition specificity and interaction with other cellular components.
Unlike some other TLR family members that exhibit broad expression across various cell types, TLR10 demonstrates a highly restricted expression pattern. Research has identified TLR10 expression in B cell lines, B cells from peripheral blood, and plasmacytoid dendritic cells from tonsil . Additionally, TLR10 has been detected in a CD1a+ dendritic cell subset derived from CD34+ progenitor cells that resemble Langerhans cells in the epidermis . This selective expression profile suggests a specialized role for TLR10 in immune surveillance and response within specific cellular contexts.
While initially believed to be predominantly expressed on various types of immune cells, more recent studies have expanded our understanding of TLR10's distribution. TLR10 has now been identified in multiple mucosal sites, including the small intestine, fallopian tubes, eye, and stomach . The presence of TLR10 at these mucosal interfaces, which represent primary sites of pathogen exposure, supports its presumed role in innate immune recognition.
Research has demonstrated that TLR10 expression can be significantly modulated in response to various stimuli, including pathogen-associated molecular patterns (PAMPs) and viral exposure. In particular, exposure to the TLR2/1 ligand Pam3CSK4 has been shown to significantly increase TLR10 expression in various cell types, including MCF-10A epithelial cells and THP-1 macrophage-like cells . Similarly, exposure to single-stranded RNA (ssRNA40) can enhance TLR10 expression .
Notably, HIV-1 exposure significantly upregulates TLR10 expression in multiple cell types, even in cells that do not support productive HIV-1 infection, such as MCF-10A epithelial cells . Studies examining breast milk (BM) from HIV-1-infected and uninfected women revealed dramatically increased TLR10 expression (over 100-fold) in HIV-1-infected samples compared to uninfected controls . This substantial upregulation of TLR10 in response to HIV-1 suggests a potential role for this receptor in viral recognition and host response mechanisms.
TLR10 exhibits unique dimerization properties that distinguish it within the TLR family. Research has shown that TLR10 can not only form homodimers with itself but also heterodimers with TLR1 and TLR2 . This heterodimerization capacity may expand the repertoire of molecular patterns recognizable by TLR10 and may influence downstream signaling outcomes. The ability to form heterodimers with TLR2 is particularly noteworthy given that TLR1 and TLR6, which are genomically clustered with TLR10, also function as TLR2 coreceptors .
Despite being classified as an orphan receptor for many years, research has provided insights into TLR10's signaling capabilities. Using a recombinant CD4TLR10 molecule, studies have demonstrated that TLR10 directly associates with MyD88, the common Toll IL-1 receptor domain adapter that mediates signaling for most TLRs . This association with MyD88 suggests that TLR10 can activate conventional TLR signaling pathways.
Furthermore, investigations have characterized regions in the Toll IL-1 receptor domain of TLR10 that are essential for the activation of promoters from certain inflammatory cytokines . These findings indicate that TLR10 engagement can lead to the transcriptional activation of inflammatory mediators, thereby contributing to the orchestration of immune responses. The exact spectrum of genes regulated by TLR10 signaling and the relative potency of this regulation compared to other TLRs requires further elucidation.
Recent research has uncovered intriguing connections between TLR10 and HIV-1 infection. Studies have identified that TLR10 can recognize HIV-1 proteins, with HIV-1 gp41 specifically identified as a TLR10 ligand . This recognition leads to the induction of IL-8 and activation of NF-κBα, suggesting that TLR10 engagement by viral components triggers inflammatory signaling cascades . The identification of gp41 as a TLR10 ligand represents a significant advance in understanding both TLR10 function and HIV-1 pathogenesis.
Surprisingly, rather than contributing to antiviral defense, TLR10 activation appears to enhance HIV-1 infection. In vitro studies using TZMbl cells demonstrated that TLR10 overexpression significantly increases HIV-1 infection and proviral DNA integration . Conversely, TLR10 inhibition through siRNA-mediated knockdown substantially decreased HIV-1 infection rates . These findings suggest that TLR10 may be exploited by HIV-1 to facilitate viral entry and replication, representing a potential immune evasion strategy.
The impact of TLR10 on HIV-1 infection has been substantiated through multiple experimental approaches:
Transfection studies in TZMbl reporter cells showed significantly increased HIV-1 infection rates when TLR10 was overexpressed compared to controls .
HIV-1 integration, as measured by proviral DNA detection, was significantly enhanced in stable TLR10-expressing cell lines compared to control cells .
siRNA-mediated knockdown of TLR10 in THP-1 macrophages resulted in significantly decreased proviral DNA production following exposure to CCR5-tropic HIV-1 (BAL strain) .
Co-transfection of TLR10 with either TLR1 or TLR2 further enhanced HIV-1 infection compared to single transfections, suggesting potential combinatorial effects .
These consistent findings across different experimental systems strongly support a role for TLR10 in facilitating HIV-1 infection, although the precise mechanisms remain to be fully elucidated.
Recombinant partial TLR10 serves as a valuable tool for various research applications. The commercially available recombinant protein with a GST tag at the N-terminal is suited for antibody production, ELISA, protein arrays, and Western blot applications . These applications enable researchers to investigate TLR10 expression, interactions, and functions in various biological contexts.
Specific research methodologies utilizing recombinant TLR10 include:
Generation of anti-TLR10 antibodies for immunodetection
Development of TLR10-specific assays to evaluate receptor activation
Protein interaction studies to identify binding partners
Structure-function analyses to map domains important for ligand recognition and signaling
The emerging understanding of TLR10's role in viral infections, particularly HIV-1, suggests potential therapeutic applications. Given that TLR10 inhibition significantly decreased HIV-1 infection in experimental models , targeting TLR10 or its interactions with viral components could represent a novel strategy for developing HIV-1 therapeutics.
Potential therapeutic approaches might include:
TLR10 antagonists to disrupt viral recognition and entry
Small molecule inhibitors of TLR10-dependent signaling
Monoclonal antibodies against TLR10 to modulate its activity
Targeted reduction of TLR10 expression in susceptible cell populations
The following studies highlight the diverse roles and clinical implications of TLR10:
Human TLR10 shares a common locus with TLR1 and TLR6 on chromosome 4p14. This genomic clustering reflects their evolutionary relationship and structural similarities. Phylogenetic analysis indicates that TLR10 is closely related to TLR1 and TLR6, likely emerging from a common TLR1/6/10 ancestor that duplicated to produce a TLR1/6 precursor and TLR10 . This genomic organization is preserved across species that maintain functional TLR10 genes, suggesting important evolutionary conservation of this receptor family.
TLR10 consists of three major domains: an extracellular domain (ECD) responsible for ligand recognition, a single-pass transmembrane (TM) helix, and an intracellular TIR (Toll/Interleukin-1 receptor) domain that mediates downstream signaling . The ECD contains multiple leucine-rich repeat motifs that form a horseshoe-like structure, similar to other TLRs. TLR10 is heavily N-glycosylated, with human TLR10 containing seven potential sites for N-glycosylation . While crystal structures exist for the TIR domain, the complete structure of TLR10 has not been experimentally determined, necessitating computational modeling approaches to understand its full-length architecture .
TLR10 exhibits both pro-inflammatory and anti-inflammatory properties, though its precise functions remain incompletely characterized . Unlike other TLRs that primarily drive inflammatory responses, emerging evidence suggests TLR10 may play a unique immunoregulatory role. It can form homodimers and heterodimers with TLR1 and TLR2, suggesting potential functional interactions with these receptors . TLR10 directly associates with the adapter protein MyD88, indicating its capacity to activate gene transcription through canonical TLR signaling pathways . The restricted expression pattern of TLR10 in specific immune cell populations further suggests specialized functions in immune regulation.
TLR10 exhibits a highly restricted expression pattern compared to other TLRs. It is predominantly expressed in:
B cell lines and primary B cells from peripheral blood
Plasmacytoid dendritic cells (pDCs) from tonsil
CD1a+ dendritic cell subset derived from CD34+ progenitor cells that resemble Langerhans cells
Notably, resting B cells stimulated with anti-μ and anti-CD40 antibodies or with Staphylococcus aureus Cowan I bacteria show increased mRNA expression of TLR10, suggesting its regulation during B cell activation . This restricted expression pattern differs from TLR1 and TLR6, despite their genomic proximity, indicating unique functions for TLR10 in specific immune cell populations.
Detection of TLR10 requires specific methodological approaches:
RNA detection: Quantitative RT-PCR using TLR10-specific primers can measure mRNA expression levels. This approach was used to identify TLR10 upregulation in stimulated B cells .
Protein detection: Western blotting with anti-TLR10 antibodies can detect the protein, which appears as a highly N-glycosylated protein. Researchers should be aware that post-translational modifications, particularly N-glycosylation, may affect antibody recognition and apparent molecular weight .
Flow cytometry: Fluorescently-labeled antibodies against TLR10 can identify TLR10-expressing cells in heterogeneous populations like peripheral blood mononuclear cells.
Immunohistochemistry: This can be used to visualize TLR10 expression in tissue sections, which has helped identify TLR10 in specific cell subsets like plasmacytoid dendritic cells in tonsil tissue .
Studies have characterized regions in the TIR domain of TLR10 that are essential for activation of inflammatory cytokine promoters . Computational modeling and dynamic network analysis suggest that TLR10 may exist in different conformational states - an "open form" that represents the functional state and a "closed form" that may represent the apo (unbound) state . Despite these insights, the complete signaling pathway remains to be fully elucidated.
TLR10 demonstrates both homodimerization and heterodimerization capabilities:
Homodimerization: TLR10 can form dimers with itself, with binding affinity measurements showing approximately 100% efficiency for homodimer formation .
Heterodimerization with TLR1: TLR10/TLR1 heterodimers form with approximately 87% binding affinity compared to homodimers .
Heterodimerization with TLR2: TLR10/TLR2 complexes form with approximately 80% binding affinity . Given that TLR1 and TLR6 function as co-receptors for TLR2, this suggests TLR10 may similarly modulate TLR2 function.
These interactions were detected through co-immunoprecipitation experiments, revealing the capacity of TLR10 to engage with other TLRs despite its unique expression pattern and functional properties .
Production of recombinant human TLR10 typically involves:
Expression systems: Mammalian cell expression systems (e.g., HEK293 cells) are preferred for proper post-translational modifications, particularly N-glycosylation which is extensive in TLR10 .
Expression vectors: Vectors containing the partial or complete TLR10 coding sequence, often with epitope tags (e.g., FLAG, His) to facilitate purification and detection.
Domain-specific constructs: Researchers may express specific domains (ECD, TIR) separately for structural or functional studies. For instance, recombinant CD4-TLR10 fusion proteins have been used to demonstrate MyD88 association .
Purification strategies: Affinity chromatography based on epitope tags followed by size exclusion chromatography to ensure homogeneity.
Quality control: SDS-PAGE, Western blotting, and mass spectrometry to confirm protein identity, glycosylation status, and purity.
Despite being considered an orphan receptor, several approaches have been employed to identify potential TLR10 ligands:
Computational modeling and docking: Structural models of TLR10-ECD have been used to predict potential ligand binding sites and interaction with candidate molecules like dsRNA .
Reporter assays: Cells expressing TLR10 linked to reporter systems (e.g., NF-κB-driven luciferase) can be screened with candidate ligands.
Constitutively active constructs: Fusion of the TLR10 TIR domain with dimerization domains can create constitutively active receptors that signal independently of ligand binding, allowing assessment of downstream signaling pathways .
Co-immunoprecipitation: This technique has been used to identify protein-protein interactions, including TLR10's association with MyD88 and other TLRs .
Binding studies: Direct binding of potential ligands to recombinant TLR10-ECD can be assessed using techniques like surface plasmon resonance or isothermal titration calorimetry.
Given the absence of a complete experimental structure for TLR10, computational modeling approaches have been employed:
Homology modeling: Using structures of related TLRs as templates. For example, the TLR10-ECD has been modeled based on TLR1, TLR2, and TLR3 structures to generate different conformational models (closed, semi-open, semi-closed, and open) .
Domain assembly: Individual domains (ECD, TM, TIR) are modeled separately and then assembled into full-length models. The TIR domain can be based on its crystal structure, while the TM domain is typically modeled as an alpha-helix .
Protein-protein docking: Used to predict dimer interfaces for TLR10 homodimers or heterodimers with other TLRs .
Molecular dynamics simulations: These simulations in membrane-aqueous environments assess the stability and dynamics of the modeled structures, revealing global motions of the ECD and TIR domains relative to the membrane .
Network analysis: Dynamic network analysis can identify key residues and interactions that differentiate functional states of the receptor .
TLR10 genetic variations have been associated with multiple diseases:
Autoimmune diseases: Rheumatoid arthritis (RA) and Crohn's disease have shown associations with TLR10 polymorphisms .
Infectious diseases: Tuberculosis, influenza, HIV, and Helicobacter pylori infections show links to TLR10 genetic variations .
Cancer: Multiple studies have connected TLR10 polymorphisms with cancer risk:
The rs11466653 SNP (Met326Thr) was found in 87.2% of papillary thyroid carcinoma patients, suggesting increased risk .
TLR10 variations have been linked to Non-Hodgkin lymphoma (NHL) .
Conversely, TLR10 rs11096955 (Ile369Leu) and rs11096957 (Asn241His) were associated with reduced prostate cancer risk .
Other conditions: IgA Nephropathy (associated with rs1004195 SNP), aspergillosis, allergenic stem cell transplantation, bladder and nasopharyngeal carcinomas have all shown associations with TLR10 polymorphisms .
Several methodological approaches can assess the impact of TLR10 polymorphisms:
Site-directed mutagenesis: Introduction of specific polymorphisms into recombinant TLR10 expression constructs.
Cell-based functional assays: Comparing wild-type and polymorphic variants for:
Protein expression and localization
Dimerization capacity with self or other TLRs
MyD88 recruitment
Activation of downstream signaling pathways (NF-κB, MAP kinases)
Cytokine production
Structural modeling: Computational approaches to predict how polymorphisms alter protein structure, ligand binding, or dimerization interfaces .
Patient-derived cells: Comparing TLR10 function in cells from individuals with different genotypes.
Population studies: Case-control studies examining the frequency of specific polymorphisms in disease versus healthy populations, as conducted for papillary thyroid carcinoma and IgA nephropathy .
The absence of a functional TLR10 in mice represents a significant challenge for researchers using mouse models. Key findings explain this evolutionary quirk:
Genomic analysis: While the mouse genome contains a TLR10 gene at the same locus as TLR1 and TLR6 (similar to humans and rats), the mouse TLR10 gene is non-functional .
Disruptive elements: The mouse TLR10 gene contains numerous gaps, insertions, and phase changes. Most critically, the TIR domain (essential for signaling) has been replaced by a retrovirus-like sequence .
Evolutionary timing: This disruption likely occurred early in mouse evolution, as diverse mouse strains including wild-derived strains (CAST/Ei and SPRET/Ei) as well as laboratory strains all contain similar vestigial TLR10 sequences .
PCR verification: Studies amplified and sequenced genomic DNA from nine unrelated mouse strains using primers designed for the signal peptide and transmembrane domains, confirming the universal disruption of TLR10 across mouse lineages .
Given the absence of functional TLR10 in mice, researchers must consider alternative approaches:
Computational modeling studies have identified multiple conformational states of TLR10:
Structural variants: Four different models of TLR10-ECD have been proposed based on templates from other TLRs: 'closed-model' (based on TLR1 homodimer), 'semi-open-model' (based on TLR2 homodimer), 'semi-closed-model' (based on TLR2-TLR1 heterodimer), and 'open-model' (based on TLR3 homodimer) .
Energetic analysis: The 'closed form' model appears energetically more favorable than the 'open form' model in simulation studies .
Functional significance: Dynamic network analysis suggests that the 'open form' model may represent the functional form that can interact with ligands, while the 'closed form' model likely represents the apo (unbound) state of TLR10 .
Conformational transitions: The mechanisms driving transitions between these states remain poorly understood but likely involve ligand binding and interaction with other TLRs.
Researchers investigating TLR10 conformations should consider molecular dynamics simulations in membrane environments to evaluate the stability and transitions between these conformational states.
TLR10 presents a fascinating evolutionary puzzle:
Unique immunoregulatory role: Unlike most TLRs that are primarily pro-inflammatory, TLR10 appears to have anti-inflammatory properties in some contexts .
Selective pressure: The preservation of TLR10 across many mammalian species (except mice) suggests important biological functions under evolutionary pressure.
Research approaches: Investigators can address this question through:
Comparative genomics across species that maintain functional TLR10
Analysis of selective pressure on different TLR10 domains
Identification of conserved versus variable regions that might relate to specialized functions
Functional studies in different species to determine conservation of anti-inflammatory properties
Understanding this evolutionary aspect may provide insights into TLR10's unique role in immune regulation and the balance between pro- and anti-inflammatory responses.
Recent evidence suggests potential interaction between TLR10 and double-stranded RNA (dsRNA):
Structural modeling: Computational studies have modeled the binding of dsRNA to TLR10 using defined and blind docking approaches .
Differential binding: Simulations indicate differential binding of dsRNA to the protomers of TLR10, which could provide insights into ligand dissociation mechanisms .
Research directions: Scientists interested in this interaction should consider:
Direct binding assays between recombinant TLR10-ECD and various dsRNA structures
Competitive binding studies with other nucleic acid-sensing TLRs
Mutational analysis of predicted RNA binding sites
Functional assays measuring signaling responses to different RNA ligands
Comparative analysis with TLR3, which is a well-characterized dsRNA sensor
This potential interaction opens new avenues for understanding TLR10's role in antiviral responses and RNA sensing.