Recombinant Human Toll-like receptor 10 (TLR10), partial

Shipped with Ice Packs
In Stock

Description

Introduction to TLR10

Toll-like receptor 10 is a member of the evolutionarily conserved Toll-like receptor family that plays a fundamental role in pathogen recognition and activation of innate immunity. TLR10 is genomically positioned within a locus that also contains TLR1 and TLR6, two receptors known to function as coreceptors for TLR2 . This genomic clustering suggests evolutionary and functional relationships among these receptors. Unlike some other TLRs, TLR10 remained categorized as an "orphan receptor" for many years due to uncertainty regarding its specific ligands and signaling mechanisms. TLR10 exhibits high conservation from Drosophila to humans and shares structural and functional similarities with other TLR family members that recognize pathogen-associated molecular patterns (PAMPs) expressed on infectious agents .

Molecular Structure and Domains

Recombinant Human TLR10 partial protein represents a specific segment of the full-length TLR10 protein. Commercial preparations typically include amino acids 171-269 of the NP_112218.2 sequence . The partial recombinant protein contains the sequence "FLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHT," which corresponds to a region within the extracellular domain of TLR10 . Like other TLRs, the full TLR10 protein is a type I transmembrane glycoprotein with an extracellular domain composed of numerous leucine-rich repeats and an intracellular region containing a Toll IL-1 receptor (TIR) homology domain .

The recombinant partial TLR10 protein is often produced with specific tags to facilitate purification and detection. For instance, commercially available recombinant TLR10 is produced with a GST-tag at the N-terminal . This fusion protein has a calculated molecular weight of approximately 36.52 kDa, which can be verified through 12.5% SDS-PAGE stained with Coomassie Blue .

Glycosylation and Post-translational Modifications

Research has established that native TLR10 exists as a highly N-glycosylated protein, which may be critical for its appropriate folding, trafficking, and function . While recombinant partial TLR10 produced in wheat germ expression systems may not fully recapitulate all post-translational modifications of the native protein, this characteristic should be considered when interpreting experimental results using such recombinant proteins. The glycosylation pattern of TLR10 may contribute to its ligand recognition specificity and interaction with other cellular components.

Cell-Specific Expression Profile

Unlike some other TLR family members that exhibit broad expression across various cell types, TLR10 demonstrates a highly restricted expression pattern. Research has identified TLR10 expression in B cell lines, B cells from peripheral blood, and plasmacytoid dendritic cells from tonsil . Additionally, TLR10 has been detected in a CD1a+ dendritic cell subset derived from CD34+ progenitor cells that resemble Langerhans cells in the epidermis . This selective expression profile suggests a specialized role for TLR10 in immune surveillance and response within specific cellular contexts.

While initially believed to be predominantly expressed on various types of immune cells, more recent studies have expanded our understanding of TLR10's distribution. TLR10 has now been identified in multiple mucosal sites, including the small intestine, fallopian tubes, eye, and stomach . The presence of TLR10 at these mucosal interfaces, which represent primary sites of pathogen exposure, supports its presumed role in innate immune recognition.

Regulation of TLR10 Expression

Research has demonstrated that TLR10 expression can be significantly modulated in response to various stimuli, including pathogen-associated molecular patterns (PAMPs) and viral exposure. In particular, exposure to the TLR2/1 ligand Pam3CSK4 has been shown to significantly increase TLR10 expression in various cell types, including MCF-10A epithelial cells and THP-1 macrophage-like cells . Similarly, exposure to single-stranded RNA (ssRNA40) can enhance TLR10 expression .

Notably, HIV-1 exposure significantly upregulates TLR10 expression in multiple cell types, even in cells that do not support productive HIV-1 infection, such as MCF-10A epithelial cells . Studies examining breast milk (BM) from HIV-1-infected and uninfected women revealed dramatically increased TLR10 expression (over 100-fold) in HIV-1-infected samples compared to uninfected controls . This substantial upregulation of TLR10 in response to HIV-1 suggests a potential role for this receptor in viral recognition and host response mechanisms.

Dimerization Capabilities

TLR10 exhibits unique dimerization properties that distinguish it within the TLR family. Research has shown that TLR10 can not only form homodimers with itself but also heterodimers with TLR1 and TLR2 . This heterodimerization capacity may expand the repertoire of molecular patterns recognizable by TLR10 and may influence downstream signaling outcomes. The ability to form heterodimers with TLR2 is particularly noteworthy given that TLR1 and TLR6, which are genomically clustered with TLR10, also function as TLR2 coreceptors .

Signaling Pathways and Adapter Recruitment

Despite being classified as an orphan receptor for many years, research has provided insights into TLR10's signaling capabilities. Using a recombinant CD4TLR10 molecule, studies have demonstrated that TLR10 directly associates with MyD88, the common Toll IL-1 receptor domain adapter that mediates signaling for most TLRs . This association with MyD88 suggests that TLR10 can activate conventional TLR signaling pathways.

Furthermore, investigations have characterized regions in the Toll IL-1 receptor domain of TLR10 that are essential for the activation of promoters from certain inflammatory cytokines . These findings indicate that TLR10 engagement can lead to the transcriptional activation of inflammatory mediators, thereby contributing to the orchestration of immune responses. The exact spectrum of genes regulated by TLR10 signaling and the relative potency of this regulation compared to other TLRs requires further elucidation.

TLR10 and HIV-1 Interaction

Recent research has uncovered intriguing connections between TLR10 and HIV-1 infection. Studies have identified that TLR10 can recognize HIV-1 proteins, with HIV-1 gp41 specifically identified as a TLR10 ligand . This recognition leads to the induction of IL-8 and activation of NF-κBα, suggesting that TLR10 engagement by viral components triggers inflammatory signaling cascades . The identification of gp41 as a TLR10 ligand represents a significant advance in understanding both TLR10 function and HIV-1 pathogenesis.

Surprisingly, rather than contributing to antiviral defense, TLR10 activation appears to enhance HIV-1 infection. In vitro studies using TZMbl cells demonstrated that TLR10 overexpression significantly increases HIV-1 infection and proviral DNA integration . Conversely, TLR10 inhibition through siRNA-mediated knockdown substantially decreased HIV-1 infection rates . These findings suggest that TLR10 may be exploited by HIV-1 to facilitate viral entry and replication, representing a potential immune evasion strategy.

Experimental Evidence and Quantitative Findings

The impact of TLR10 on HIV-1 infection has been substantiated through multiple experimental approaches:

  1. Transfection studies in TZMbl reporter cells showed significantly increased HIV-1 infection rates when TLR10 was overexpressed compared to controls .

  2. HIV-1 integration, as measured by proviral DNA detection, was significantly enhanced in stable TLR10-expressing cell lines compared to control cells .

  3. siRNA-mediated knockdown of TLR10 in THP-1 macrophages resulted in significantly decreased proviral DNA production following exposure to CCR5-tropic HIV-1 (BAL strain) .

  4. Co-transfection of TLR10 with either TLR1 or TLR2 further enhanced HIV-1 infection compared to single transfections, suggesting potential combinatorial effects .

These consistent findings across different experimental systems strongly support a role for TLR10 in facilitating HIV-1 infection, although the precise mechanisms remain to be fully elucidated.

Laboratory Techniques and Methodologies

Recombinant partial TLR10 serves as a valuable tool for various research applications. The commercially available recombinant protein with a GST tag at the N-terminal is suited for antibody production, ELISA, protein arrays, and Western blot applications . These applications enable researchers to investigate TLR10 expression, interactions, and functions in various biological contexts.

Specific research methodologies utilizing recombinant TLR10 include:

  1. Generation of anti-TLR10 antibodies for immunodetection

  2. Development of TLR10-specific assays to evaluate receptor activation

  3. Protein interaction studies to identify binding partners

  4. Structure-function analyses to map domains important for ligand recognition and signaling

Potential Therapeutic Applications

The emerging understanding of TLR10's role in viral infections, particularly HIV-1, suggests potential therapeutic applications. Given that TLR10 inhibition significantly decreased HIV-1 infection in experimental models , targeting TLR10 or its interactions with viral components could represent a novel strategy for developing HIV-1 therapeutics.

Potential therapeutic approaches might include:

  1. TLR10 antagonists to disrupt viral recognition and entry

  2. Small molecule inhibitors of TLR10-dependent signaling

  3. Monoclonal antibodies against TLR10 to modulate its activity

  4. Targeted reduction of TLR10 expression in susceptible cell populations

Product Specs

Buffer
For liquid delivery forms, the protein is stored in a Tris/PBS-based buffer containing 5-50% glycerol. Note: Specify your desired glycerol concentration when ordering if different from the default.
Form
Available in liquid or lyophilized powder form. Note: While we prioritize shipping the available format, please specify your preferred format at the time of order to ensure fulfillment of your request.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized powder maintains stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
TLR10; UNQ315/PRO358; Toll-like receptor 10; CD antigen CD290
Datasheet & Coa
Please contact us to get it.
Expression Region
20-576aa
Mol. Weight
68.1kDa
Protein Length
Partial
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
others
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMRTIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNILTDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWPETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTDLPGCSHFSRLSVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYSEVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Toll-like receptor 10 (TLR10) participates in the innate immune response to microbial agents. It signals through MYD88 and TRAF6, leading to NF-κB activation, cytokine secretion, and the inflammatory response.
Gene References Into Functions

The following studies highlight the diverse roles and clinical implications of TLR10:

  1. Polymorphisms in the TLR10 gene may increase the risk of post-bronchiolitis asthma in preschool children. (PMID: 28592890)
  2. The rs4129009 polymorphism has been associated with increased risk of persistent asthma and the need for inhaled corticosteroids. (PMID: 28692144)
  3. The TLR10 992AA genotype may increase, while the 720CC genotype may decrease, susceptibility to Crimean-Congo hemorrhagic fever (CCHF). TLR10 polymorphisms may serve as biomarkers for CCHF susceptibility and fatality. (PMID: 28843003)
  4. The TLR10 rs10004195 A/T heterozygous and T/T homozygous genotypes are associated with specific gastric mucosal patterns, suggesting a role in H. pylori-associated gastritis severity. (PMID: 28699598)
  5. Increased TLR10 gene/protein expression in adipose tissue is linked to obesity and type 2 diabetes (T2D), potentially involving ROS-mediated oxidative stress, NF-κB, MAPK signaling, and the ER stress response. (PMID: 29428931)
  6. The TLR10 I473T allelic variant shows impaired NF-κB inhibitory activity and is associated with rheumatoid arthritis severity and response to infliximab. (PMID: 27716427)
  7. TLR10 is a regulator of innate immune responses and monocyte differentiation into dendritic cells. (PMID: 28235773)
  8. TLR10 functions as a broad negative regulator of TLR signaling. (PMID: 27022193)
  9. TLR10 plays a distinct functional role within the B cell lineage compared to other TLR family members. (PMID: 27956526)
  10. Genetic variation in the TLR10-TLR1-TLR6 gene cluster mediates responsiveness to organic dust, affecting IL-6 and TNF-α signaling pathways. (PMID: 28123183)
  11. TLR10 is involved in the recognition of various ligands, but TLR-ligand-induced TNF-α expression does not depend on TLR10. (PMID: 27258267)
  12. Polymorphisms in TLR10 are not associated with chronic Q fever. (PMID: 26364993)
  13. Variants at 4p14, associated with TLR6/10 and FAM114A1 expression, are linked to the host immune response to H. pylori infection, but not acquisition. (PMID: 26312625)
  14. TLR1 rs4833095 and TLR10 rs10004195 confer susceptibility to gastroduodenal disease, particularly gastric cancer in H. pylori infection. (PMID: 26559190)
  15. Genetic variants in TLR10 are associated with protection against complicated skin and skin structure infections. (PMID: 25895985)
  16. TLR1 rs4833095 and TLR10 rs10004195 may play crucial roles in H. pylori susceptibility and gastric pathogenesis. (PMID: 25687912)
  17. TLR10 polymorphisms may contribute to the pathogenesis of autoimmune thyroid diseases. (PMID: 25295614)
  18. A single nucleotide polymorphism (SNP) in TLR10 (rs11096957) is associated with tuberculosis risk. (PMID: 25857634)
  19. Genetic variation rs5743565 in TLR1 might decrease Graves' disease susceptibility, while TLR6 and TLR10 polymorphisms were not significantly associated. (PMID: 25028161)
  20. TLR10 (rs4129009) gene differences were observed between low and high tumor infiltration stages. (PMID: 22504414)
  21. Genetic markers in TLR1, TLR4, TLR5, TLR6 and TLR10 were associated with acute graft-versus-host disease following hematopoietic stem cell transplantation. (PMID: 22703024)
  22. Genetic variation in TLR10 influences Crohn's disease susceptibility and clinical outcome. (PMID: 22342453)
  23. No significant differences were found in TLR3 and TLR10 genotypes between rheumatoid arthritis patients and controls. (PMID: 20422193)
  24. Absence of a common haplotype in the TLR10-TLR1-TLR6 gene cluster increases the risk of chronic sarcoidosis. (PMID: 22150367)
  25. The TLR10 gene single nucleotide polymorphism rs10004195 was associated with immunoglobulin A nephropathy (IgAN) in Korean children. (PMID: 20953797)
  26. Pam(3)CSK(4) is a ligand for the hTLR10/2 complex, activating hTLR10/1 hetero- and hTLR10 homodimers. (PMID: 20877634)
  27. TLR10 genetic variation is associated with allergic rhinitis in asthma in a Chinese population (PMID: 20815312)
  28. Human TLR10 cooperates with TLR2 in sensing microbes and fungi but has distinct signaling properties from other TLR2 subfamily members. (PMID: 20348427)
  29. In the reproductive tract, TLR10 expression is primarily restricted to the fallopian tube. (PMID: 19406482)
  30. IL-13/IL-4 and TLR-10 might be involved in the genetics of preterm births. (PMID: 19332998)
  31. TLR10 is a potential asthma candidate gene, with genetic variation contributing to asthma risk. (PMID: 15201134)
  32. TLR10 is expressed in a highly restricted manner as a highly N-glycosylated protein in B cell lines, peripheral blood B cells, and tonsil plasmacytoid dendritic cells. (PMID: 15728506)
  33. Multiple associated SNPs at the TLR6-TLR1-TLR10 gene cluster suggest a founder prostate cancer risk variant. (PMID: 15812078)
  34. Sequence variants in the TLR6, TLR1, and TLR10 gene cluster are associated with prostate cancer. (PMID: 17932345)
  35. The TLR10 structure is consistent with biochemical data on TLR receptors and serves as a model for the physiological dimer. (PMID: 18332149)
  36. A common haplotype in the TLR10-TLR1-TLR6 gene cluster influences prostate cancer risk. (PMID: 18752252)
Database Links

HGNC: 15634

OMIM: 606270

KEGG: hsa:81793

STRING: 9606.ENSP00000308925

UniGene: Hs.120551

Protein Families
Toll-like receptor family
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Highly expressed in spleen, lymph node, thymus, tonsil and at lower levels in lung. Highly expressed in promyelocytic HL-60 cells and in B-cell lines.

Q&A

What is the genomic location of human TLR10 and how does it relate to other TLRs?

Human TLR10 shares a common locus with TLR1 and TLR6 on chromosome 4p14. This genomic clustering reflects their evolutionary relationship and structural similarities. Phylogenetic analysis indicates that TLR10 is closely related to TLR1 and TLR6, likely emerging from a common TLR1/6/10 ancestor that duplicated to produce a TLR1/6 precursor and TLR10 . This genomic organization is preserved across species that maintain functional TLR10 genes, suggesting important evolutionary conservation of this receptor family.

What is known about TLR10's protein structure?

TLR10 consists of three major domains: an extracellular domain (ECD) responsible for ligand recognition, a single-pass transmembrane (TM) helix, and an intracellular TIR (Toll/Interleukin-1 receptor) domain that mediates downstream signaling . The ECD contains multiple leucine-rich repeat motifs that form a horseshoe-like structure, similar to other TLRs. TLR10 is heavily N-glycosylated, with human TLR10 containing seven potential sites for N-glycosylation . While crystal structures exist for the TIR domain, the complete structure of TLR10 has not been experimentally determined, necessitating computational modeling approaches to understand its full-length architecture .

What are the proposed functions of TLR10?

TLR10 exhibits both pro-inflammatory and anti-inflammatory properties, though its precise functions remain incompletely characterized . Unlike other TLRs that primarily drive inflammatory responses, emerging evidence suggests TLR10 may play a unique immunoregulatory role. It can form homodimers and heterodimers with TLR1 and TLR2, suggesting potential functional interactions with these receptors . TLR10 directly associates with the adapter protein MyD88, indicating its capacity to activate gene transcription through canonical TLR signaling pathways . The restricted expression pattern of TLR10 in specific immune cell populations further suggests specialized functions in immune regulation.

Which cell types express TLR10?

TLR10 exhibits a highly restricted expression pattern compared to other TLRs. It is predominantly expressed in:

  • B cell lines and primary B cells from peripheral blood

  • Plasmacytoid dendritic cells (pDCs) from tonsil

  • CD1a+ dendritic cell subset derived from CD34+ progenitor cells that resemble Langerhans cells

Notably, resting B cells stimulated with anti-μ and anti-CD40 antibodies or with Staphylococcus aureus Cowan I bacteria show increased mRNA expression of TLR10, suggesting its regulation during B cell activation . This restricted expression pattern differs from TLR1 and TLR6, despite their genomic proximity, indicating unique functions for TLR10 in specific immune cell populations.

How can researchers detect TLR10 expression in experimental systems?

Detection of TLR10 requires specific methodological approaches:

  • RNA detection: Quantitative RT-PCR using TLR10-specific primers can measure mRNA expression levels. This approach was used to identify TLR10 upregulation in stimulated B cells .

  • Protein detection: Western blotting with anti-TLR10 antibodies can detect the protein, which appears as a highly N-glycosylated protein. Researchers should be aware that post-translational modifications, particularly N-glycosylation, may affect antibody recognition and apparent molecular weight .

  • Flow cytometry: Fluorescently-labeled antibodies against TLR10 can identify TLR10-expressing cells in heterogeneous populations like peripheral blood mononuclear cells.

  • Immunohistochemistry: This can be used to visualize TLR10 expression in tissue sections, which has helped identify TLR10 in specific cell subsets like plasmacytoid dendritic cells in tonsil tissue .

What is known about TLR10 signaling pathways?

Studies have characterized regions in the TIR domain of TLR10 that are essential for activation of inflammatory cytokine promoters . Computational modeling and dynamic network analysis suggest that TLR10 may exist in different conformational states - an "open form" that represents the functional state and a "closed form" that may represent the apo (unbound) state . Despite these insights, the complete signaling pathway remains to be fully elucidated.

How does TLR10 interact with other TLRs?

TLR10 demonstrates both homodimerization and heterodimerization capabilities:

  • Homodimerization: TLR10 can form dimers with itself, with binding affinity measurements showing approximately 100% efficiency for homodimer formation .

  • Heterodimerization with TLR1: TLR10/TLR1 heterodimers form with approximately 87% binding affinity compared to homodimers .

  • Heterodimerization with TLR2: TLR10/TLR2 complexes form with approximately 80% binding affinity . Given that TLR1 and TLR6 function as co-receptors for TLR2, this suggests TLR10 may similarly modulate TLR2 function.

These interactions were detected through co-immunoprecipitation experiments, revealing the capacity of TLR10 to engage with other TLRs despite its unique expression pattern and functional properties .

What methods are used to produce recombinant human TLR10?

Production of recombinant human TLR10 typically involves:

  • Expression systems: Mammalian cell expression systems (e.g., HEK293 cells) are preferred for proper post-translational modifications, particularly N-glycosylation which is extensive in TLR10 .

  • Expression vectors: Vectors containing the partial or complete TLR10 coding sequence, often with epitope tags (e.g., FLAG, His) to facilitate purification and detection.

  • Domain-specific constructs: Researchers may express specific domains (ECD, TIR) separately for structural or functional studies. For instance, recombinant CD4-TLR10 fusion proteins have been used to demonstrate MyD88 association .

  • Purification strategies: Affinity chromatography based on epitope tags followed by size exclusion chromatography to ensure homogeneity.

  • Quality control: SDS-PAGE, Western blotting, and mass spectrometry to confirm protein identity, glycosylation status, and purity.

What approaches have been used to identify potential TLR10 ligands?

Despite being considered an orphan receptor, several approaches have been employed to identify potential TLR10 ligands:

  • Computational modeling and docking: Structural models of TLR10-ECD have been used to predict potential ligand binding sites and interaction with candidate molecules like dsRNA .

  • Reporter assays: Cells expressing TLR10 linked to reporter systems (e.g., NF-κB-driven luciferase) can be screened with candidate ligands.

  • Constitutively active constructs: Fusion of the TLR10 TIR domain with dimerization domains can create constitutively active receptors that signal independently of ligand binding, allowing assessment of downstream signaling pathways .

  • Co-immunoprecipitation: This technique has been used to identify protein-protein interactions, including TLR10's association with MyD88 and other TLRs .

  • Binding studies: Direct binding of potential ligands to recombinant TLR10-ECD can be assessed using techniques like surface plasmon resonance or isothermal titration calorimetry.

How can researchers model the structure of full-length TLR10?

Given the absence of a complete experimental structure for TLR10, computational modeling approaches have been employed:

  • Homology modeling: Using structures of related TLRs as templates. For example, the TLR10-ECD has been modeled based on TLR1, TLR2, and TLR3 structures to generate different conformational models (closed, semi-open, semi-closed, and open) .

  • Domain assembly: Individual domains (ECD, TM, TIR) are modeled separately and then assembled into full-length models. The TIR domain can be based on its crystal structure, while the TM domain is typically modeled as an alpha-helix .

  • Protein-protein docking: Used to predict dimer interfaces for TLR10 homodimers or heterodimers with other TLRs .

  • Molecular dynamics simulations: These simulations in membrane-aqueous environments assess the stability and dynamics of the modeled structures, revealing global motions of the ECD and TIR domains relative to the membrane .

  • Network analysis: Dynamic network analysis can identify key residues and interactions that differentiate functional states of the receptor .

What disease associations have been identified for TLR10 polymorphisms?

TLR10 genetic variations have been associated with multiple diseases:

  • Autoimmune diseases: Rheumatoid arthritis (RA) and Crohn's disease have shown associations with TLR10 polymorphisms .

  • Infectious diseases: Tuberculosis, influenza, HIV, and Helicobacter pylori infections show links to TLR10 genetic variations .

  • Cancer: Multiple studies have connected TLR10 polymorphisms with cancer risk:

    • The rs11466653 SNP (Met326Thr) was found in 87.2% of papillary thyroid carcinoma patients, suggesting increased risk .

    • TLR10 variations have been linked to Non-Hodgkin lymphoma (NHL) .

    • Conversely, TLR10 rs11096955 (Ile369Leu) and rs11096957 (Asn241His) were associated with reduced prostate cancer risk .

  • Other conditions: IgA Nephropathy (associated with rs1004195 SNP), aspergillosis, allergenic stem cell transplantation, bladder and nasopharyngeal carcinomas have all shown associations with TLR10 polymorphisms .

How can researchers investigate the functional consequences of TLR10 polymorphisms?

Several methodological approaches can assess the impact of TLR10 polymorphisms:

  • Site-directed mutagenesis: Introduction of specific polymorphisms into recombinant TLR10 expression constructs.

  • Cell-based functional assays: Comparing wild-type and polymorphic variants for:

    • Protein expression and localization

    • Dimerization capacity with self or other TLRs

    • MyD88 recruitment

    • Activation of downstream signaling pathways (NF-κB, MAP kinases)

    • Cytokine production

  • Structural modeling: Computational approaches to predict how polymorphisms alter protein structure, ligand binding, or dimerization interfaces .

  • Patient-derived cells: Comparing TLR10 function in cells from individuals with different genotypes.

  • Population studies: Case-control studies examining the frequency of specific polymorphisms in disease versus healthy populations, as conducted for papillary thyroid carcinoma and IgA nephropathy .

Why is there no functional mouse homologue of TLR10?

The absence of a functional TLR10 in mice represents a significant challenge for researchers using mouse models. Key findings explain this evolutionary quirk:

  • Genomic analysis: While the mouse genome contains a TLR10 gene at the same locus as TLR1 and TLR6 (similar to humans and rats), the mouse TLR10 gene is non-functional .

  • Disruptive elements: The mouse TLR10 gene contains numerous gaps, insertions, and phase changes. Most critically, the TIR domain (essential for signaling) has been replaced by a retrovirus-like sequence .

  • Evolutionary timing: This disruption likely occurred early in mouse evolution, as diverse mouse strains including wild-derived strains (CAST/Ei and SPRET/Ei) as well as laboratory strains all contain similar vestigial TLR10 sequences .

  • PCR verification: Studies amplified and sequenced genomic DNA from nine unrelated mouse strains using primers designed for the signal peptide and transmembrane domains, confirming the universal disruption of TLR10 across mouse lineages .

What alternative animal models can be used to study TLR10 function?

Given the absence of functional TLR10 in mice, researchers must consider alternative approaches:

How do open and closed conformations of TLR10 relate to its function?

Computational modeling studies have identified multiple conformational states of TLR10:

  • Structural variants: Four different models of TLR10-ECD have been proposed based on templates from other TLRs: 'closed-model' (based on TLR1 homodimer), 'semi-open-model' (based on TLR2 homodimer), 'semi-closed-model' (based on TLR2-TLR1 heterodimer), and 'open-model' (based on TLR3 homodimer) .

  • Energetic analysis: The 'closed form' model appears energetically more favorable than the 'open form' model in simulation studies .

  • Functional significance: Dynamic network analysis suggests that the 'open form' model may represent the functional form that can interact with ligands, while the 'closed form' model likely represents the apo (unbound) state of TLR10 .

  • Conformational transitions: The mechanisms driving transitions between these states remain poorly understood but likely involve ligand binding and interaction with other TLRs.

Researchers investigating TLR10 conformations should consider molecular dynamics simulations in membrane environments to evaluate the stability and transitions between these conformational states.

What is the potential relationship between TLR10's anti-inflammatory properties and its evolutionary conservation?

TLR10 presents a fascinating evolutionary puzzle:

  • Unique immunoregulatory role: Unlike most TLRs that are primarily pro-inflammatory, TLR10 appears to have anti-inflammatory properties in some contexts .

  • Selective pressure: The preservation of TLR10 across many mammalian species (except mice) suggests important biological functions under evolutionary pressure.

  • Research approaches: Investigators can address this question through:

    • Comparative genomics across species that maintain functional TLR10

    • Analysis of selective pressure on different TLR10 domains

    • Identification of conserved versus variable regions that might relate to specialized functions

    • Functional studies in different species to determine conservation of anti-inflammatory properties

Understanding this evolutionary aspect may provide insights into TLR10's unique role in immune regulation and the balance between pro- and anti-inflammatory responses.

How might the interaction between TLR10 and dsRNA contribute to its function?

Recent evidence suggests potential interaction between TLR10 and double-stranded RNA (dsRNA):

  • Structural modeling: Computational studies have modeled the binding of dsRNA to TLR10 using defined and blind docking approaches .

  • Differential binding: Simulations indicate differential binding of dsRNA to the protomers of TLR10, which could provide insights into ligand dissociation mechanisms .

  • Research directions: Scientists interested in this interaction should consider:

    • Direct binding assays between recombinant TLR10-ECD and various dsRNA structures

    • Competitive binding studies with other nucleic acid-sensing TLRs

    • Mutational analysis of predicted RNA binding sites

    • Functional assays measuring signaling responses to different RNA ligands

    • Comparative analysis with TLR3, which is a well-characterized dsRNA sensor

This potential interaction opens new avenues for understanding TLR10's role in antiviral responses and RNA sensing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.