Recombinant Human torovirus Hemagglutinin-esterase (HE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HE; Hemagglutinin-esterase; HE protein; E3 glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
15-416
Protein Length
Full Length of Mature Protein
Species
Human torovirus (HuTV)
Target Names
HE
Target Protein Sequence
VTPVTPYFGPLYITFNCCLFGDSRSDCTKVQSPMSLDNPQNFCPNFSLKSSSSMFFSIHY NNHSSLVLFDNFNCRIEKVYYNGVNLSPRNQYSCYDEGVDSYMELKTSFNIKLNQMATIL RCIKLIQLKARSSFTTLQDVVCRTNKYLPNNPTFALLSDTVPTWVQFVLPDLSGKTICIK YLVPFCHLNHGCFTAGSSCPPFGVSYVSDSFNYGFNDATPYIGLAESHDNVCDYLFVEAG THNASIVGNFLFYPTKSYCFNTMNFTVPVQAIQSIWSEGNESDDAIAEACKPPFCIYYSK TTPYTVTNGSNADHRDDEVRMMVRGLLYNSSCISAQGSTPLALYSTAMLYAPIYGSCPQY VKLFDTSGSESVDVISSSYFVATWVLLVVVVILIFVIISFFC
Uniprot No.

Target Background

Function

Recombinant Human torovirus Hemagglutinin-esterase (HE) is a structural protein forming short surface spikes on the virus. It exhibits receptor-binding and receptor-destroying activities, mediating the de-O-acetylation of N-acetyl-9-O-acetylneuraminic acid—a likely receptor determinant recognized by the virus on erythrocyte and susceptible cell surfaces. This receptor-destroying activity is crucial for viral release, preventing self-aggregation and ensuring efficient cell-to-cell progeny virus spread. HE may function as a secondary viral attachment protein, initiating infection alongside the primary spike protein. While not strictly essential for viral infection in culture, its presence can influence pathogenicity. HE may be a target for both humoral and cellular immune responses.

Protein Families
Influenza type C/coronaviruses hemagglutinin-esterase family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is the structural organization of human torovirus hemagglutinin-esterase protein?

Human torovirus (HTV) hemagglutinin-esterase is a class I glycoprotein of approximately 65 kDa that mediates reversible attachment to O-acetylated sialic acids . The protein functions both as a lectin (binding to sialic acid receptors) and as a receptor-destroying enzyme through its esterase activity .

Unlike influenza C virus HEF (hemagglutinin-esterase fusion protein) which forms trimers, torovirus HEs likely form homodimers similar to coronavirus HEs . The protein consists of:

  • A highly conserved esterase domain containing a Ser-His-Asp catalytic triad

  • A unique lectin domain that differs substantially from other viral HEs

  • A transmembrane anchor domain

Notably, torovirus HEs lack the fusion domain present in influenza C virus HEF . The quaternary structure transformation from trimer (as in influenza-like ancestors) to dimer was accompanied by adaptation of remnants of the fusion domain to establish novel monomer-monomer contacts .

How does human torovirus HE differ from other viral hemagglutinin-esterases?

Human torovirus HE shares approximately 85% sequence identity with bovine torovirus (BToV) HE genes and 89% identity with the BEV (Berne virus) X pseudogene sequence . In comparative analyses with other viral HEs:

FeatureHuman Torovirus HEBovine Torovirus HECoronavirus HEInfluenza C HEF
Quaternary StructureLikely dimerLikely dimerDimerTrimer
Fusion ActivityAbsentAbsentAbsentPresent
Sialic Acid Preference9-O-acetylated sialic acidsVariable (strain-dependent)Mostly 9-O-acetylated9-O-acetylated
Sequence Identity to HTV100%~85%~30%~30%
Essential for ReplicationNoNoNoYes

A distinctive feature of torovirus HEs is their unique receptor-binding sites, which evolved independently from those of coronaviruses and influenza viruses . While the esterase domain architecture remains highly conserved across these viral families, the receptor-binding domains underwent substantial remodeling, resulting in ligand binding in opposite orientation compared to influenza C HEF .

What expression systems have been successfully used for recombinant human torovirus HE production?

The baculovirus expression system has been successfully employed for recombinant production of human torovirus HE . The methodological approach involves:

  • Amplification of the 1.2kb HE gene from the human torovirus genome using long RT-PCR

  • Cloning of the amplicon into a baculovirus transfer vector

  • Co-transfection of insect cells with the recombinant transfer vector and baculovirus DNA

  • Selection and propagation of recombinant baculoviruses

  • Infection of insect cells for protein expression

  • Purification of the expressed protein by sodium dodecyl sulfate-polyacrylamide gel electrophoresis

The expressed HE protein has been confirmed to be approximately 65 kDa in size, consistent with the predicted molecular weight . The purified recombinant protein retains antigenic properties, reacting with both bovine and human torovirus-positive specimens in immunoblot and dot blot analyses .

How do recombination events shape the evolution of human torovirus HE genes?

Recombination events have played a pivotal role in the evolution of torovirus HE genes . Both heterologous (between different viruses) and homologous (within the same viral species) RNA recombination have been documented:

  • Heterologous recombination: Ancestral toroviruses likely acquired the HE gene through horizontal gene transfer from a cellular or viral donor . This acquisition occurred after the evolutionary split between coronaviruses and toroviruses .

  • Interspecies recombination: Evidence exists for recombination between bovine toroviruses and porcine toroviruses, particularly at the 3'-ends of ORF1b and the HE gene . This has resulted in chimeric HE genes.

  • Novel recombination patterns: A recently identified antelope torovirus (AToV) appears to be the previously unknown torovirus parent that contributed to recombinant HE genes in certain bovine torovirus strains (B150, B155) . These strains contain HE genes with segments derived from three different sources:

    • ~10% from a BToV parent

    • ~10% from a PToV parent

    • ~80% from AToV

The high sequence identity (91.7-92.0% nucleotide, 94.8% amino acid) between the HE genes of AToV and the recombinant BToV strains provides strong evidence for this recombination history .

Surprisingly, these recombination events have connected geographically distant hosts - Tibetan antelopes in China and Dutch veal calves in the Netherlands - suggesting the existence of intermediate hosts that facilitated virus transmission .

What methodologies can be used to study the receptor-binding specificity of recombinant human torovirus HE?

Studying the receptor-binding specificity of recombinant human torovirus HE requires multiple complementary approaches:

  • Crystal structure analysis:

    • Protein crystallization in complex with receptor analogs

    • X-ray diffraction analysis

    • Structure determination to identify binding pocket architecture

  • Structure-guided mutagenesis:

    • Site-directed mutagenesis of residues in the putative binding pocket

    • Expression of mutant proteins

    • Functional analysis through binding assays

  • Glycan binding assays:

    • Solid-phase lectin binding assays using glycan arrays

    • Hemagglutination assays with erythrocytes bearing different sialic acid modifications

    • Surface plasmon resonance to determine binding kinetics

  • Histochemistry approaches:

    • Tissue staining using recombinant HE proteins as probes

    • Enzyme-linked immunosorbent assays with various sialylated glycans

Research has shown that human torovirus HE, like other torovirus HEs, primarily recognizes 9-O-acetylated sialic acids . The binding pocket is formed by specific hydrophobic residues that accommodate the 9-O-acetyl group, which is essential for receptor recognition .

What is the functional significance of the esterase activity in human torovirus HE proteins?

The esterase domain of human torovirus HE functions as a receptor-destroying enzyme (RDE) that cleaves acetyl groups from O-acetylated sialic acids . This activity serves several important functions:

  • Reversible attachment: By removing the acetyl groups from sialic acids, the esterase activity allows the virus to release from its receptor after attachment, preventing irreversible binding that would trap virions at the cell surface .

  • Penetration of mucus layers: The esterase may help the virus penetrate through mucus layers rich in sialylated glycans to reach target cells.

  • Prevention of virion aggregation: By modifying sialic acids on viral glycoproteins, the esterase may prevent self-aggregation of virions.

  • Immune evasion: Modification of host cell surface sialic acids may help the virus evade immune recognition.

Structure-guided biochemical analysis has revealed that a functionally conserved arginine-sialic acid carboxylate interaction is critical for binding and positioning glycosidically bound sialic acids in the catalytic pocket . While this interaction is essential for efficient de-O-acetylation, it does not directly affect substrate specificity .

The catalytic mechanism involves a Ser-His-Asp triad, similar to other serine hydrolases, with the serine acting as the nucleophile that attacks the carbonyl carbon of the acetyl group .

How can researchers generate and characterize recombinant toroviruses expressing modified HE proteins?

A reverse genetics system using a full-length infectious cDNA clone of bovine torovirus (BToV) in a bacterial artificial chromosome (BAC) has been developed and could be adapted for human toroviruses . This system allows for manipulation of the HE gene to study its functions:

Methodology for generating recombinant toroviruses with modified HE:

  • Construction of BAC-based full-length viral genome:

    • Clone full-length viral genome into BAC vector

    • Introduce desired modifications into the HE gene using site-directed mutagenesis or gene replacement

  • Transfection and virus rescue:

    • Transfect cells with the recombinant BAC

    • Recover infectious virus from supernatant

    • Plaque-purify recombinant viruses

  • Characterization approaches:

    • Plaque morphology analysis

    • Growth kinetics in cell culture

    • Immunofluorescence detection of viral proteins

    • α-NA esterase assays to detect enzymatic activity

    • Immunoblotting for protein expression analysis

Using this approach, researchers have successfully generated several types of recombinant BToVs including:

  • Viruses expressing full-length HE (HEf)

  • Viruses expressing HA-tagged HEf or soluble HE (HEs)

  • Viruses in which HE was replaced by reporter genes like EGFP

How can the substrate specificity of human torovirus HE be determined experimentally?

Determining the substrate specificity of human torovirus HE requires a combination of enzymatic assays and structural analyses:

  • Synthetic substrate assays:

    • Prepare p-nitrophenyl acetate (pNPA) derivatives of different sialic acid variants

    • Incubate with purified recombinant HE protein

    • Measure release of p-nitrophenol spectrophotometrically

    • Compare hydrolysis rates for different substrates

  • Natural substrate assays:

    • Isolate various O-acetylated sialoglycoconjugates

    • Incubate with recombinant HE protein

    • Analyze de-O-acetylation using HPLC or mass spectrometry

    • Quantify substrate preference based on reaction kinetics

  • Structure-guided mutagenesis:

    • Identify residues in the substrate-binding pocket through structural analysis

    • Generate point mutations in these residues

    • Express and purify mutant proteins

    • Assess changes in substrate preference

Research has shown that different torovirus HEs exhibit distinct substrate preferences. For instance, while bovine torovirus HEs can cleave both 7,9-di-O- and 9-mono-O-acetylated sialic acids, porcine torovirus HEs strongly prefer 9-mono-O-acetylated substrates . This difference can be attributed to a single residue variation in the esterase pocket .

The human torovirus HE likely follows similar substrate recognition principles, with specificity determined by the architecture of its binding pocket. Examining the hydrophobic pocket that accommodates the 9-O-acetyl group (formed by residues equivalent to Phe 219, Ile 182, Leu 180, and Phe 272 in porcine torovirus HE) would be particularly informative .

What techniques can be used to investigate the role of human torovirus HE in viral pathogenesis?

Investigating the role of human torovirus HE in viral pathogenesis requires multifaceted approaches:

  • Reverse genetics approaches:

    • Generate recombinant viruses with wild-type HE, enzymatically inactive HE, or no HE

    • Compare viral replication, spread, and pathogenicity

    • Create chimeric viruses with HE proteins from different strains

  • Animal infection models:

    • Inoculate animal models with recombinant viruses

    • Monitor clinical symptoms, viral load, and tissue distribution

    • Analyze viral antigen spread through immunohistochemistry

    • Compare survival rates and disease progression

  • Ex vivo tissue culture systems:

    • Use intestinal organoids or tissue explants

    • Compare infection patterns between wild-type and HE-modified viruses

    • Perform transcriptomic analysis to identify host response differences

  • Receptor distribution analysis:

    • Map the distribution of O-acetylated sialic acids in target tissues

    • Correlate receptor presence with viral tropism

    • Use recombinant HE proteins as histochemical probes

Studies with recombinant murine hepatitis virus (a coronavirus) expressing heterologous HE have shown that HE expression can enhance viral spread within the central nervous system and increase neurovirulence, even when the protein is enzymatically inactive . This suggests that HE may function primarily as an attachment protein in some contexts, enhancing the efficiency of infection .

For human toroviruses, which are associated with gastroenteritis, the HE protein may play roles in tissue tropism, viral shedding, and transmission. The ability of HE to bind specific O-acetylated sialic acids might determine which cell types and tissues can be infected.

How can researchers assess the immunogenicity and diagnostic potential of recombinant human torovirus HE?

Assessment of immunogenicity and diagnostic potential of recombinant human torovirus HE involves several complementary approaches:

  • Immunization studies:

    • Immunize animal models with purified recombinant HE

    • Collect sera and assess antibody titers by ELISA

    • Characterize antibody specificity through immunoblotting and neutralization assays

    • Evaluate protective efficacy against viral challenge

  • Epitope mapping:

    • Generate a panel of monoclonal antibodies against recombinant HE

    • Identify binding regions through competition assays, peptide scanning, and structural analysis

    • Determine neutralizing vs. non-neutralizing epitopes

  • Diagnostic assay development:

    • Design ELISA systems using recombinant HE as capture antigen

    • Develop immunoblot and dot blot protocols for antibody detection

    • Validate assays with known positive and negative clinical specimens

    • Determine sensitivity and specificity parameters

Previous research has demonstrated that hyperimmune sera prepared against recombinant HE proteins from both bovine and human toroviruses can react specifically with a 65 kDa protein corresponding to the torovirus HE protein . These sera react with torovirus-positive fecal specimens by immunoblot and dot blot analysis, and can aggregate torovirus particles in immunoelectron microscopy .

Importantly, human convalescent sera from patients infected with human torovirus have been shown to react with recombinant HE protein in immunoblot assays, confirming the immunogenicity of HE during natural infections . This indicates that recombinant HE has significant potential as a diagnostic antigen for detecting torovirus infections in clinical settings.

How can researchers distinguish between recombinant human torovirus HE and related viral HEs in experimental settings?

Distinguishing between human torovirus HE and related viral HEs requires multiple analytical approaches:

  • Immunological differentiation:

    • Develop specific monoclonal antibodies targeting unique epitopes

    • Perform western blots with antibodies against species-specific determinants

    • Use competitive ELISAs to detect binding pattern differences

  • Molecular characterization:

    • PCR amplification with species-specific primers

    • Restriction fragment length polymorphism (RFLP) analysis

    • DNA sequencing of amplified HE genes

  • Functional differentiation:

    • Compare substrate preferences using panel of O-acetylated sialic acids

    • Analyze receptor binding specificity with glycan arrays

    • Measure enzymatic kinetics with different substrates

  • Structural analysis:

    • Compare quaternary structures (dimers vs. trimers)

    • Analyze glycosylation patterns through lectin binding or mass spectrometry

    • Compare thermal stability profiles

Human torovirus HE shares approximately 85% sequence identity with bovine torovirus HEs but only about 30% with coronavirus and influenza C virus HEs . These sequence differences can be exploited to design specific detection methods. Additionally, while the esterase domains are highly conserved, the receptor-binding domains are substantially different, which allows for functional differentiation .

The architecture of the binding site in torovirus HEs is fundamentally different from those in coronavirus HEs and influenza C HEF . These structural differences result in distinct binding characteristics that can be used for differentiation in experimental settings.

What are the key challenges in maintaining the stability and functionality of recombinant human torovirus HE during purification and storage?

Maintaining stability and functionality of recombinant human torovirus HE presents several challenges:

  • Structural integrity:

    • HE proteins contain intramolecular disulfide bonds critical for proper folding

    • The dimeric structure must be preserved for optimal functionality

    • Denaturation can expose hydrophobic regions leading to aggregation

  • Glycosylation preservation:

    • Native glycosylation patterns affect stability and antigenicity

    • Expression systems may produce different glycoforms

    • Enzymatic or chemical processing can alter glycan structures

  • Enzymatic activity retention:

    • The catalytic Ser-His-Asp triad is sensitive to pH changes

    • Oxidation of catalytic residues can inactivate the enzyme

    • Substrate binding pocket integrity must be maintained

Recommended methodological approaches:

ChallengeStrategyImplementation
Protein foldingOxidative refoldingControlled redox environment with glutathione ratio optimization
Aggregation preventionStabilizing additivesAddition of glycerol (10-20%), low concentrations of non-ionic detergents
Activity preservationpH optimizationBuffer systems maintaining pH 6.5-7.5
Freeze-thaw damageCryoprotectantsAddition of sucrose or trehalose at 5-10%
Long-term storageLyophilizationFreeze-drying in presence of stabilizing excipients

For structural studies requiring highly purified protein, a multi-step purification approach is recommended:

  • Affinity chromatography (using lectins or metal chelate resins)

  • Ion exchange chromatography

  • Size exclusion chromatography to ensure dimeric state

Storage conditions should be optimized to maintain both lectin and esterase activities. Generally, storage at -80°C in small aliquots with cryoprotectants is recommended to minimize freeze-thaw cycles.

How can researchers reconcile conflicting data regarding human torovirus HE sequences and evolution?

Researchers face several challenges in reconciling conflicting data about human torovirus HE:

An instructive example comes from studies of human torovirus HE sequences that appeared almost identical to BEV in the 3' untranslated region but substantially different from bovine and porcine toroviruses . This raised concerns about PCR contamination versus genuine evolutionary relationships. To resolve such issues:

  • Obtain samples from geographically and temporally diverse sources

  • Use sample-specific barcoding in amplification steps

  • Include appropriate negative controls

  • Sequence multiple genome segments to confirm consistent evolutionary patterns

  • Consider structural and functional constraints when interpreting unusual sequence conservation

What novel approaches could advance our understanding of human torovirus HE structure-function relationships?

Several innovative approaches could significantly advance our understanding of human torovirus HE:

  • Cryo-electron microscopy (cryo-EM):

    • Visualize HE in context of intact virions at near-atomic resolution

    • Study conformational changes upon receptor binding

    • Examine interactions with other viral proteins

    • Characterize the dimeric architecture in native conditions

  • Single-molecule biophysics:

    • Measure binding kinetics to different sialylated glycans

    • Observe conformational dynamics during substrate binding and catalysis

    • Quantify mechanical stability of HE dimers

  • Integrative structural biology:

    • Combine X-ray crystallography, NMR, SAXS, and computational modeling

    • Develop complete models of HE interaction with cellular receptors

    • Characterize dynamic regions not visible in crystal structures

  • Advanced glycobiology approaches:

    • Develop synthetic glycan arrays with systematic modifications

    • Use glycan editing enzymes to modify cellular receptors

    • Apply metabolic glycoengineering to control receptor presentation

  • Protein engineering and directed evolution:

    • Create chimeric HE proteins to map functional domains

    • Apply directed evolution to identify critical residues for specificity

    • Engineer biosensors based on HE for detecting O-acetylated sialic acids

These approaches would help resolve key questions about human torovirus HE, particularly regarding the plasticity of its receptor-binding site compared to the more conserved architecture in influenza viruses . The evolutionary flexibility of torovirus HE may be related to functional redundancy with the companion spike protein S, allowing greater exploration of alternative binding-site topologies .

How might recombinant human torovirus HE be utilized in developing broad-spectrum antiviral strategies?

Recombinant human torovirus HE offers several potential avenues for developing broad-spectrum antiviral strategies:

  • Receptor analogs as viral entry inhibitors:

    • Design sialic acid mimetics that bind the lectin domain with high affinity

    • Develop multivalent inhibitors to increase avidity and blocking potency

    • Create receptor decoys that irreversibly bind viral attachment proteins

  • Esterase inhibitors to prevent virion release:

    • Identify compounds that selectively inhibit viral sialate-O-acetylesterases

    • Design transition-state analogs for the esterase catalytic site

    • Develop covalent inhibitors targeting the catalytic serine residue

  • Structure-based drug design:

    • Target conserved regions in the HE protein across different viruses

    • Design compounds that disrupt the dimeric structure

    • Develop allosteric inhibitors that prevent conformational changes

  • Chimeric antiviral proteins:

    • Engineer recombinant HE fused to immunoglobulin Fc regions for extended half-life

    • Create HE-based competitive inhibitors of viral attachment

    • Develop decoy receptors incorporating HE binding domains

The high conservation of the esterase domain structure across toroviruses, coronaviruses, and influenza C virus makes it an attractive target for broad-spectrum antivirals. Compounds targeting this domain could potentially inhibit multiple viral families that utilize O-acetylated sialic acids as receptors.

Research has shown that the catalytic mechanism involving the Ser-His-Asp triad is essentially identical across these viral families , suggesting that esterase inhibitors might have broad applicability. Such inhibitors could serve as lead compounds for developing antivirals effective against multiple respiratory and enteric viruses.

What implications does the study of human torovirus HE have for understanding viral protein evolution after horizontal gene transfer?

The study of human torovirus HE provides valuable insights into viral protein evolution following horizontal gene transfer:

  • Functional adaptation versus conservation:

    • The esterase domain maintains high structural conservation despite sequence divergence

    • The receptor-binding domain underwent extensive remodeling, resulting in ligand binding in opposite orientation compared to the ancestral protein

    • This demonstrates that some domains can tolerate substantial remodeling while others remain functionally constrained

  • Quaternary structure evolution:

    • Transformation from a trimeric influenza-like ancestor to a dimeric structure

    • Repurposing of remnants of the fusion domain to establish new monomer-monomer contacts

    • Shows how viral proteins can evolve novel quaternary structures through domain repurposing

  • Selective pressure modulation:

    • The evolutionary flexibility of torovirus HE receptor-binding sites may be enabled by functional redundancy with the spike protein S

    • This demonstrates how functional context affects evolutionary constraints and opportunities

    • Explains why some viral proteins maintain conserved binding architectures over large evolutionary distances while others diverge rapidly

  • Recombination as an ongoing evolutionary force:

    • Continued recombination among torovirus HE genes creates chimeric proteins with segments from multiple viral species

    • Demonstrates that gene acquisition through horizontal transfer is not a one-time event but can be followed by further genetic exchange

    • Explains the mosaic nature of many viral proteins

The unusual plasticity of the torovirus HE receptor-binding site contrasts with the conservation seen in influenza virus hemagglutinin, which maintained its basic architecture despite extensive antigenic variation and a switch in receptor specificity . This suggests that the level of functional redundancy within a viral genome significantly impacts the evolutionary trajectories of horizontally acquired genes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.