Recombinant Human Torsin-1A-interacting protein 1 (TOR1AIP1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Torsin-1A-Interacting Protein 1 (TOR1AIP1)

Torsin-1A-interacting protein 1, encoded by the TOR1AIP1 gene in humans, is also known as lamina-associated polypeptide 1 (LAP1) . It is a type II integral membrane protein found in the inner nuclear membrane . The TOR1AIP1 gene is highly conserved across different species, which highlights its fundamental importance in cellular processes .

Structure and Function

LAP1 consists of two functional isoforms, LAP1B and LAP1C . The luminal domain of LAP1 interacts with Torsin A and is necessary for the ATPase activity of Torsin A . This protein is essential for maintaining cellular homeostasis and responding to environmental cues . It influences the activity of mTORC1, which is a regulator of cellular metabolism and growth .

TOR1AIP1 is involved in various cellular processes . It is required for nuclear membrane integrity and induces TOR1A and TOR1B ATPase activity, and is also needed for their location on the nuclear membrane . Furthermore, it binds to A- and B-type lamins and has a possible role in membrane attachment and assembly of the nuclear lamina .

Associated Diseases

Mutations in TOR1AIP1 have been associated with several diseases :

  • Muscular dystrophy

  • Cardiomyopathy

  • Cancer Increased risk of certain cancers, including breast and lung cancer

  • Neurodevelopmental disorders Dysfunction has been linked to neurodevelopmental disorders, particularly those affecting brain growth and function

  • Metabolic disorders Alterations in expression or function may contribute to metabolic disorders, such as obesity and diabetes

TOR1AIP1 and Cancer Research

TOR1AIP1 expression has been explored across different cancer types to investigate its potential predictive value in cancer prognosis and therapy, with a particular emphasis on kidney renal clear cell carcinoma . Deregulation of TOR1AIP1 expression has been observed in multiple cancer types .

TOR1AIP1-Associated Nuclear Envelopathies

TOR1AIP1 encodes LAP1, a nuclear envelope protein expressed in most human tissues and linked to various biological processes and human diseases . The clinical spectrum of diseases related to mutations in TOR1AIP1 is broad, including muscular dystrophy, congenital myasthenic syndrome, cardiomyopathy, and multisystemic disease with or without progeroid features .

Interactions with TorsinA

LAP1 recruits torsinA to the nuclear envelope and modulates TorsinA ATPase activity . TOR1AIP1-knockout mice have morphological abnormalities in their neuronal nuclear membranes, similar to those observed in neurons from DYT1 mice model lacking torsinA . In fibroblasts lacking LAP1, the localization of torsinA shifted from the nuclear envelope toward the endoplasmic reticulum .

Interactions with Protein Phosphatase PP1 and TRF2

The protein phosphatase PP1 interacts with the N-terminal domain of LAP1B in vitro and in vivo . TRF2 interacts with LAP1 in human cell lines in response to DNA damage induced by PP1 and PP2A-inhibiting agents . When phosphorylated, LAP1 has a greater affinity to TRF2 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
TOR1AIP1; LAP1; Torsin-1A-interacting protein 1; Lamin-associated protein 1B; LAP1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-583
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFS DEPPEVYGDFEPLVAKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQETE EMKTRRTTRLQQQHSEQPPLQPSPVMTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSI QEAPVSEDLVIRLRRPPLRYPRYEATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSR DSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLSSGYQKTPQEWAPQTARIRTR MQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWWLLPLIAALASGSFWFFSTPEV ETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEE ALRCLSEQIADAYSSFRSVRAIRIDGTDKATQDSDTVKLEVDQELSNGFKNGQNAAVVHR FESFPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEVEEKVRDFLKVKF TNSNTPNSYNHMDPDKLNGLWSRISHLVLPVQPENALKRGICL
Uniprot No.

Target Background

Function
Essential for maintaining nuclear membrane integrity. It induces TOR1A and TOR1B ATPase activity and is crucial for their nuclear membrane localization. It binds to A- and B-type lamins, suggesting a role in membrane attachment and nuclear lamina assembly.
Gene References Into Functions
  • LAP1 (encoded by TOR1AIP1) may contribute to dysferlinopathy pathogenesis. PMID: 28110863
  • LAP1 co-localizes with acetylated alpha-tubulin in the mitotic spindle and with gamma-tubulin in centrosomes (the primary microtubule organizing center) in mitotic cells. PMID: 25323962
  • Studies show that an arginine 563 mutation in LAP1 reduces its ability to stimulate TorsinA ATPase hydrolysis. PMID: 25149450
  • Research describes a novel autosomal recessive nuclear envelope disease caused by a homozygous mutation in exon 1 of TOR1AIP1 (encoding LAP1B). This expands the range of genes associated with nuclear envelopathies and highlights the critical function of LAP1B in striated muscle. PMID: 24856141
  • The protein phosphatase 1 (PP1) binding domain in LAP1B was identified as the REVRF motif (amino acids 55-59). PMID: 24116158
  • Molecular cloning of LAP1B and the role of its protein domains in LAP1B localization to nuclear and endoplasmic reticulum membranes were determined. PMID: 12061773
Database Links

HGNC: 29456

OMIM: 614512

KEGG: hsa:26092

STRING: 9606.ENSP00000393292

UniGene: Hs.496459

Involvement In Disease
Limb-girdle muscular dystrophy 2Y (LGMD2Y)
Protein Families
TOR1AIP family
Subcellular Location
Nucleus inner membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in muscle, liver and kidney.

Q&A

What is TOR1AIP1 and what protein does it encode?

TOR1AIP1 (Torsin-1A-interacting protein 1) is a gene that encodes lamina-associated polypeptide 1 (LAP1), a type 2 integral membrane protein localized in the inner nuclear membrane. LAP1 binds to both A- and B-type lamins and is involved in maintaining the attachment of the nuclear membrane to the nuclear lamina during cell division . In humans, two primary isoforms have been identified: LAP1B and LAP1C, which are generated through alternative splicing of the TOR1AIP1 pre-mRNA . LAP1 is ubiquitously expressed in most human tissues and has been implicated in various biological processes and diseases .

What is the genomic context and structure of TOR1AIP1?

The TOR1AIP1 gene is located on chromosome 1q25.2 and spans from positions 179882285 to 179920076 on NC_000001.11. The gene contains 10 exons . Analysis of alternative splicing patterns has revealed:

FeatureHuman TOR1AIP1
Chromosome location1q25.2
Total exons10
Known human isoformsLAP1B, LAP1C
Alternative exons identifiedExons 1b, 2b, 3b (based on EST alignment)

Bioinformatic analysis using BLAST algorithm and splice prediction tools (NNSPLICE and GENSCAN) have identified potential alternative exons in the human TOR1AIP1 gene, including exons 1b, 2b, and 3b, which may contribute to additional isoform diversity .

What are the primary functions of LAP1 in cellular processes?

LAP1 participates in multiple cellular processes:

  • Nuclear envelope integrity: Maintains attachment between nuclear membrane and nuclear lamina

  • Chromatin binding: Associates with chromatin through its nucleoplasmic domain

  • Torsin ATPase regulation: Activates Torsin1A and Torsin1B through its luminal domain

  • Nuclear lamina organization: Interacts with A- and B-type lamins

  • Cell division: Important for proper nuclear envelope dynamics during mitosis

Studies show that LAP1's interaction with Torsins influences its chromatin-binding activity, suggesting bidirectional communication across the nuclear membrane .

What diseases are associated with TOR1AIP1 mutations?

Mutations in TOR1AIP1 are associated with several disorders, summarized in the following table:

DiseaseClinical FeaturesMutation TypeReference
Limb-girdle muscular dystrophy type 2Y (LGMD2Y)Proximal muscle weakness, progressive to distal, contractures, rigid spine, cardiomyopathyVarious, including c.186delG (p.E62fsTer25)
Congenital myasthenic syndromeNeuromuscular junction dysfunctionVarious
Multisystemic disease with progeroid featuresSevere neurological impairment, microcephaly, brain atrophy, congenital heart malformations, cataract, growth retardationRecurrent homozygous nonsense mutation affecting both LAP1 isoforms
Dystonia with cardiomyopathy and cerebellar atrophyHyperkinetic movement disorder, cardiac dysfunctionMutation affecting torsinA binding domain

These conditions follow autosomal recessive inheritance patterns, with most affected individuals showing homozygous mutations .

What methodological approaches are optimal for studying TOR1AIP1 expression and localization?

For comprehensive analysis of TOR1AIP1 expression and localization, researchers should employ multiple complementary techniques:

  • Transcript analysis:

    • Quantitative real-time PCR (qPCR) with isoform-specific primers to distinguish LAP1B and LAP1C expression levels

    • RNA-seq for comprehensive splicing pattern identification

  • Protein detection:

    • Western blotting using antibodies targeting specific domains (e.g., nucleoplasmic versus luminal domains)

    • Immunofluorescence microscopy for subcellular localization

  • Expression systems:

    • Recombinant LAP1 production in E. coli systems has been successful. For human TOR1AIP1, a single polypeptide chain containing 333 amino acids (21-332) with a molecular mass of 38kDa, fused to a 21 amino acid His-tag at the N-terminus, can be purified using proprietary chromatographic techniques

    • Optimal formulation conditions: 20mM Tris-HCl buffer (pH 8.0), 0.4M Urea and 10% glycerol

    • Storage recommendations: 4°C for short-term (2-4 weeks) or -20°C with carrier protein (0.1% HSA or BSA) for long-term storage

  • Functional assays:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure LAP1 mobility at the nuclear envelope

    • Co-immunoprecipitation studies to analyze LAP1-protein interactions

These approaches should be combined with appropriate controls, including LAP1 mutants that affect specific functions (e.g., R563G that impairs Torsin activation) .

How does the LAP1-Torsin interaction influence chromatin binding and nuclear envelope dynamics?

The interaction between LAP1 and Torsins creates a remarkable trans-membrane signaling system that influences nuclear chromatin organization:

  • Bidirectional signaling mechanism:

    • LAP1's C-terminal luminal domain activates Torsin ATPase activity through an arginine finger (R563)

    • Torsins, in turn, modulate LAP1's nucleoplasmic domain interaction with chromatin

  • Experimental evidence for functional coupling:

    • Co-expression of Torsin1B rescues nuclear envelope aberrations caused by LAP1B overexpression, but only when Torsin's ATPase activity is intact

    • ATPase-deficient Torsin mutant (E178Q) reduces LAP1B mobility in lamin-depleted cells

    • LAP1 mutations (R563G, E482A) that impair Torsin activation show decreased mobility compared to wild-type protein

  • Molecular model:

    • Unlike classical AAA+ ATPases that thread substrates through a central pore, Torsins lack the characteristic pore loops for substrate gripping

    • Torsins may form homo-oligomeric structures (spiral or lock-washer configuration) with LAP1 binding to promote oligomer disassembly upon ATPase activation

    • The precise stoichiometry and higher-order configurations of LAP1-Torsin complexes in living cells remain to be determined

This cross-membrane regulation has significant implications for understanding nuclear envelope-associated diseases and demonstrates how protein interactions across the nuclear membrane coordinate nuclear architecture.

What are the molecular mechanisms underlying phenotypic variability in TOR1AIP1-related disorders?

The remarkable phenotypic spectrum of TOR1AIP1-related disorders appears to arise from complex genotype-phenotype relationships:

  • Impact on protein isoforms:

    • Mutations affecting both LAP1B and LAP1C isoforms (e.g., recurrent homozygous nonsense mutation) cause multisystemic disease with progeroid features and early lethality

    • Mutations affecting primarily LAP1B may result in predominant muscular phenotypes

  • Tissue-specific effects:

    • Despite ubiquitous expression, certain tissues show greater vulnerability to LAP1 dysfunction

    • Neurons appear particularly sensitive to alterations in LAP1-torsinA interactions, possibly due to involvement of additional proteins (torsinB, printor, nesprin-3α) in this pathway

    • Muscle tissue vulnerability may relate to specific nuclear envelope stresses in contractile cells

  • Functional domains affected:

    • Mutations in the luminal domain affecting torsinA binding (e.g., E482A) are associated with dystonia and cardiomyopathy

    • Mutations causing frameshift and early termination (e.g., p.E62fsTer25) lead to complete absence of LAP1B with primary muscle phenotypes

  • Compensatory mechanisms:

    • Overexpression of LULL1 (an ER-resident partner of torsinA) has been observed in muscle lacking LAP1B, suggesting potential compensatory mechanisms

    • The presence of tissue-specific binding partners may partially compensate for LAP1 dysfunction in certain contexts

Understanding these complex relationships requires integrated approaches combining genomic, transcriptomic, proteomic, and functional studies in relevant tissue models.

What imaging techniques provide optimal assessment of TOR1AIP1-related pathology in muscle and other tissues?

Magnetic Resonance Imaging (MRI) has emerged as a crucial tool for characterizing the muscular phenotype in TOR1AIP1-related disorders, with specific findings that may distinguish it from other muscular dystrophies:

  • Sequential MRI findings in TOR1AIP1 muscular dystrophy:

    • Early disease: No significant muscular atrophy, with heterogeneous STIR hyperintensity of lower extremity muscles

    • Advanced disease: Extensive atrophy of lower extremities with severe progression, including:

      • Gluteal muscles

      • Iliopsoas

      • Rectus femoris

      • Obturator internus

      • Significant atrophy of rectus abdominis and internal and external oblique muscles

      • Iliacus muscles

  • Distinctive pattern compared to other muscular dystrophies:

    • More proximal involvement of lower extremities

    • Preservation of tibialis anterior, which distinguishes it from MYH7-related myopathies that typically show early tibialis anterior involvement

  • Complementary imaging techniques:

    • Ultrastructural examination using electron microscopy reveals:

      • Intact sarcomeric organization

      • Alterations of the nuclear envelope including nuclear fragmentation

      • Chromatin bleb formation

      • Naked chromatin

  • Brain imaging in multisystemic disease:

    • Global brain atrophy

    • Microcephaly

These imaging characteristics, when combined with genetic and pathological workup, are crucial for accurate diagnosis and potential treatment of TOR1AIP1-related disorders.

How can researchers investigate the role of TOR1AIP1 in cancer biology?

Recent evidence suggests TOR1AIP1 may have roles in cancer pathogenesis and potential as a biomarker:

  • Expression analysis across cancer types:

    • Comprehensive analysis of multiple cancer databases has shown significant deregulation of TOR1AIP1 expression in multiple cancer types

    • Particular emphasis on kidney renal clear cell carcinoma has been noted

  • Clinical correlation methodologies:

    • Investigation of TOR1AIP1 expression correlation with:

      • Survival rates

      • Drug sensitivity

      • Clinical outcomes

  • Experimental approaches:

    • Gene expression analysis using cancer genomics databases (e.g., The Cancer Genome Atlas)

    • Functional studies to determine mechanistic roles in cancer progression

    • Analysis of protein-protein interactions relevant to cancer pathways

  • Potential as predictive and immunological biomarker:

    • Assessment of TOR1AIP1 as prognostic indicator

    • Evaluation of relationship with immune response in tumor microenvironment

This emerging area requires further experimental investigations to understand the significance of TOR1AIP1 in different cancer types and its potential utility as a biomarker.

What are the current challenges in developing therapeutic approaches for TOR1AIP1-related disorders?

Developing therapies for TOR1AIP1-related disorders faces several significant challenges:

  • Mechanistic complexity:

    • The bidirectional signaling between LAP1 and Torsins across the nuclear membrane creates complex molecular pathology

    • LAP1's interactions with multiple proteins (lamins, chromatin, Torsins) complicate therapeutic targeting

  • Tissue specificity considerations:

    • Despite ubiquitous expression, TOR1AIP1 mutations affect tissues differently

    • Therapeutic approaches may need tissue-specific delivery or targeting

  • Compensatory mechanisms:

    • The relationship between LAP1 and LULL1 suggests compensatory effects on each other

    • Understanding these compensatory pathways may reveal therapeutic opportunities

  • Genetic therapy challenges:

    • Most pathogenic mutations cause loss of protein function or expression

    • Gene replacement strategies would need to achieve appropriate expression levels without disrupting nuclear envelope homeostasis

  • Experimental model limitations:

    • Differences between species in LAP1 isoform expression and function

    • Need for human cell-based models that recapitulate tissue-specific pathology

  • Heterogeneity of clinical manifestations:

    • The broad spectrum of phenotypes (from isolated muscular dystrophy to multisystemic disease) complicates clinical trial design and outcome measures

Research strategies focusing on enhancing compensatory mechanisms, modulating Torsin activity, or targeting downstream pathways may offer promising approaches for these rare but devastating disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.