Recombinant Human TPA-induced transmembrane protein (TTMP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human TPA-Induced Transmembrane Protein (TTMP)

Recombinant Human TPA-induced transmembrane protein (TTMP) is a protein that is upregulated by 12-O-Tetradecanoylphorbol-13-acetate (TPA) in the pancreatic cancer cell line CD18 . TPA is a potent tumor promoter known for producing diverse and sometimes opposing effects within cells . TTMP is a single-pass transmembrane protein of 217 residues that localizes to the endoplasmic reticulum .

Identification and Characterization

In silico analysis first identified TTMP as a novel gene upregulated following treatment with TPA . Researchers validated these initial in silico results through real-time PCR in CD18 and HeLa cells, confirming that the upregulation of TTMP is both time- and concentration-dependent . Further investigation using a luciferase reporter assay revealed that TPA triggers TTMP upregulation at the promoter level .

4.1. Upregulation of TTMP by TPA

Oligonucleotide microarray analysis was employed to identify genes upregulated by TPA in the CD18 pancreatic cancer cell line . Real-time PCR was then used to validate the microarray data, confirming the upregulation of TTMP in both CD18 and HeLa cells .

4.2. Luciferase Reporter Assay

A luciferase reporter assay was conducted to determine the mechanism by which TPA upregulates TTMP expression . The results of this assay demonstrated that TPA triggers TTMP upregulation at the promoter level, indicating that TPA directly influences the transcription of the TTMP gene .

Tables

ExperimentCell LineTreatmentResult
Oligonucleotide microarrayCD18TPATTMP identified as upregulated
Real-time PCRCD18/HeLaTPATTMP upregulation confirmed, time-dependent
Luciferase reporter assayN/ATPAUpregulation triggered at the promoter level

Potential Implications and Future Directions

Further studies are needed to fully understand the role of TTMP in cancer biology and its potential as a therapeutic target.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag type is required, please specify this in your order; we will prioritize fulfilling your request.
Synonyms
TTMP; C3orf52; TPA-induced transmembrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-217
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TTMP
Target Protein Sequence
MDLAQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNV VGRCKLWMIITSIFLGVITVIIIGLCLAAVTYVDEDENEILELSSNKTFFIMLKIPEECV AEEELPHLLTERLTDVYSTSPSLGRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKY MMSEELVLGILLQDFRDQNIPGCESLGLDPTSLLLYE
Uniprot No.

Target Background

Database Links

HGNC: 26255

OMIM: 611956

KEGG: hsa:79669

UniGene: Hs.434247

Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

What is TTMP and how was it identified in scientific literature?

TTMP (TPA-induced transmembrane protein) is a novel protein identified through oligonucleotide microarray analysis as a gene upregulated following treatment with 12-O-Tetradecanoylphorbol-13-acetate (TPA) in the pancreatic cancer cell line CD18. The discovery was validated using real-time PCR in both CD18 and HeLa cells, which confirmed that TTMP upregulation follows both time-dependent and concentration-dependent patterns. The gene encodes a single-pass transmembrane protein of 217 amino acid residues that localizes to the endoplasmic reticulum .

Research methodology for identifying TTMP involved a systematic approach beginning with differential gene expression analysis following TPA treatment, followed by validation using more targeted techniques. Luciferase reporter assays demonstrated that the upregulation mechanism specifically occurs at the promoter level, suggesting transcriptional regulation rather than post-transcriptional mechanisms .

What experimental systems are appropriate for studying TTMP expression?

Based on current literature, TTMP expression has been successfully studied in:

  • Pancreatic cancer cell line CD18: The original discovery model that demonstrated robust TTMP upregulation following TPA treatment

  • HeLa cells: Secondary validation model confirming similar expression patterns

For researchers initiating TTMP studies, these established cell models provide reliable systems for investigating regulation mechanisms. When designing experiments, it's important to consider both dose-dependent and time-course analyses, as TTMP expression demonstrates sensitivity to both TPA concentration and exposure duration .

How does TTMP differ from other transmembrane proteins associated with tPA signaling?

TTMP is distinct from membrane proteins that interact with tissue plasminogen activator (tPA) such as LRP-1 (low-density lipoprotein receptor-related protein 1). While TTMP is induced by the tumor promoter TPA and localizes to the endoplasmic reticulum, proteins like LRP-1 serve as receptors for tPA and mediate cellular responses to tPA binding .

The key distinction lies in their functional relationships: TTMP is a gene product whose expression is triggered by TPA exposure, while LRP-1 is a constitutively expressed receptor that mediates responses to tPA binding. LRP-1 has been extensively characterized for its role in mediating tPA-induced neutrophil migration and NET formation, whereas TTMP's functional characterization remains limited .

What methodological approaches are recommended for characterizing TTMP's subcellular localization and trafficking?

To thoroughly characterize TTMP localization and trafficking, researchers should implement a multi-technique strategy:

  • Fluorescence microscopy approaches:

    • Confocal microscopy with organelle-specific markers (particularly ER markers like calnexin)

    • Live-cell imaging with fluorescently tagged TTMP to track dynamic trafficking

    • Super-resolution microscopy for precise localization within organelle subdomains

  • Biochemical fractionation:

    • Differential centrifugation followed by western blotting

    • Density gradient fractionation for higher resolution separation of membrane compartments

    • Protease protection assays to determine topology within the ER membrane

  • Proximity labeling techniques:

    • BioID or APEX2 fusion proteins to identify proximal interacting partners

    • RUSH system (Retention Using Selective Hooks) to synchronize and track protein trafficking

What is the relationship between TPA concentration and TTMP expression dynamics?

For researchers exploring this question, the following experimental approach is recommended:

  • Establish a dose-response curve using multiple TPA concentrations (0.001-10 μM range)

  • Measure TTMP mRNA levels by RT-qPCR at multiple timepoints (1, 3, 6, 12, 24, 48 hours)

  • Confirm protein expression dynamics using western blotting and pulse-chase experiments

  • Determine the EC50 value for TPA-induced TTMP expression

  • Compare the concentration-effect relationship across multiple cell types

This approach would provide valuable insights into whether TTMP expression exhibits threshold effects, saturation kinetics, or biphasic responses, which could inform both the basic biology of TTMP and potential techniques for modulating its expression in experimental systems .

What molecular mechanisms regulate TPA-induced TTMP transcription?

While the promoter-level regulation of TTMP by TPA has been established through luciferase reporter assays , the specific molecular mechanisms remain largely uncharacterized. Researchers investigating this question should consider examining:

  • Transcription factor binding:

    • Perform in silico analysis of the TTMP promoter region to identify potential transcription factor binding sites

    • Conduct ChIP assays to identify factors that bind to the TTMP promoter following TPA treatment

    • Use EMSA to confirm direct binding interactions

  • Signaling pathways:

    • Since TPA is known to activate protein kinase C (PKC), examine the role of PKC signaling using specific inhibitors

    • Test MAP kinase pathway involvement with inhibitors of ERK, JNK, and p38

    • Investigate potential crosstalk with other signaling pathways activated by TPA

  • Chromatin modifications:

    • Assess histone modifications at the TTMP promoter before and after TPA treatment

    • Examine DNA methylation status and its potential change following TPA exposure

Understanding these mechanisms would provide insight into how TTMP expression is integrated into the broader cellular response to TPA and potentially reveal new approaches for modulating its expression in research contexts .

What protein-protein interactions might influence TTMP function?

Given TTMP's localization to the endoplasmic reticulum, potential protein interaction partners may include:

  • ER quality control machinery:

    • Chaperones (BiP/GRP78, calnexin, calreticulin)

    • ERAD components (HRD1, SEL1L, EDEM family)

  • ER stress response proteins:

    • Sensors (IRE1α, PERK, ATF6)

    • Downstream effectors (XBP1, ATF4, CHOP)

  • Membrane trafficking components:

    • COPII coat proteins for anterograde transport

    • COPI components for retrograde transport

    • Tethering and fusion machinery

To systematically identify interaction partners, researchers should consider employing:

  • Proximity labeling techniques (BioID, APEX)

  • Co-immunoprecipitation followed by mass spectrometry

  • Yeast two-hybrid or mammalian two-hybrid screening

  • FRET-based interaction assays for suspected partners

These approaches would help establish TTMP's functional interaction network and potentially reveal its role in specific cellular processes such as protein folding, quality control, or stress response pathways relevant to its TPA-induced expression .

How might recombinant expression systems be optimized for TTMP production and functional studies?

For researchers interested in producing recombinant TTMP for functional studies, several considerations and approaches should be addressed:

  • Expression system selection:

    • Mammalian expression systems (HEK293, CHO cells) would likely provide proper folding and post-translational modifications

    • Alternatively, insect cell systems (Sf9, Hi5) may offer higher yields while maintaining eukaryotic processing

    • Bacterial systems might be suitable for truncated soluble domains but challenging for full-length transmembrane protein

  • Vector design considerations:

    • Include epitope tags (His, FLAG, HA) for purification and detection

    • Consider inducible promoters to control expression timing

    • For membrane proteins, inclusion of a cleavable signal sequence may improve targeting

  • Optimization strategies:

    • Temperature modulation (30-37°C) to balance expression and proper folding

    • Addition of chemical chaperones to culture media

    • Codon optimization for the expression host

  • Purification approach:

    • Detergent screening to identify optimal solubilization conditions

    • Two-step purification combining affinity chromatography with size exclusion

    • Reconstitution into nanodiscs or liposomes for functional studies

  • Functional validation:

    • Circular dichroism to confirm secondary structure

    • Limited proteolysis to assess proper folding

    • Activity assays based on hypothesized function

Similar approaches have been successfully used for the production of other transmembrane proteins, including receptors like LRP-1 that interact with tissue plasminogen activator .

How do TPA-induced proteins compare to tPA-regulated membrane proteins?

While TTMP is induced by 12-O-Tetradecanoylphorbol-13-acetate (TPA), tissue plasminogen activator (tPA) interacts with various membrane proteins to regulate cellular functions. Key differences include:

CharacteristicTPA-induced TTMPtPA-regulated membrane proteins (e.g., LRP-1)
Induction mechanismTranscriptional upregulationPost-translational regulation and signaling
Primary locationEndoplasmic reticulumCell surface membrane
Cellular responseUnknown, possibly tumor promotionCell migration, inflammation, NET formation
Pathway involvementUnknownPI3K/Akt signaling pathway
Temporal dynamicsTime and concentration dependentRapid response to tPA binding

The fundamental difference is that TTMP represents a gene product whose expression increases in response to TPA, while proteins like LRP-1 are constitutively expressed receptors that mediate rapid cellular responses upon tPA binding .

Could techniques used to study tPA-membrane protein interactions be applied to TTMP research?

Several methodological approaches used in tPA-membrane protein interaction studies could be adapted for TTMP research:

  • Modified Boyden chamber migration assays: While used to demonstrate tPA-induced neutrophil chemotaxis , this technique could be adapted to assess whether TTMP expression affects cell migration in response to various stimuli.

  • Pharmacological inhibition approaches: The use of specific pathway inhibitors (as done with MAP kinase inhibitors in tPA studies) could help identify signaling pathways affected by TTMP expression .

  • Real-time PCR, immunocytochemistry, and cytofluorimetry: These techniques, used to demonstrate LRP-1 synthesis in response to tPA , could be optimized to study TTMP expression patterns across different cell types and conditions.

  • Inhibition experiments using specific antagonists: Similar to the use of RAP to inhibit LRP-1 , developing specific inhibitors or antagonists for TTMP could help elucidate its function.

  • Western blot analysis for detecting activation markers: This approach, used to detect changes in protein expression like H3Cit in tPA studies , could be adapted to identify downstream effects of TTMP expression.

Adapting these methodologies requires careful consideration of TTMP's subcellular localization and potential function, but they provide established frameworks that could accelerate TTMP functional characterization .

Is there evidence for functional overlap between TTMP and tPA-responsive membrane proteins?

  • ER-plasma membrane contact sites: TTMP's localization to the ER could potentially influence plasma membrane receptors like LRP-1 through ER-plasma membrane contact sites, which are known to regulate calcium signaling and lipid transfer.

  • Protein trafficking and quality control: As an ER resident protein, TTMP might participate in the folding, quality control, or trafficking of membrane receptors, potentially including those that respond to tPA.

  • Shared signaling pathways: Both TPA (which induces TTMP) and tPA activate various signaling pathways, including PKC and MAPK cascades. TTMP might modulate these shared signaling nodes.

  • Stress response integration: Both TPA stimulation and tPA signaling can influence cellular stress responses. TTMP might function in integrating these responses at the ER level.

These potential connections remain speculative based on current literature and represent important areas for future research to establish whether functional relationships exist between these distinct but potentially related systems .

What is the potential role of TTMP in cancer biology?

Given that TTMP was discovered as a gene upregulated by TPA, a potent tumor promoter, in pancreatic cancer cells, there are several potential roles TTMP might play in cancer biology:

  • Cell proliferation and survival: As a TPA-responsive gene, TTMP might participate in signaling pathways that promote cancer cell proliferation or survival, particularly those involving protein kinase C activation.

  • ER stress adaptation: Cancer cells often face ER stress due to increased protein synthesis demands and hypoxia. TTMP's localization to the ER suggests it might function in adaptive responses to ER stress, potentially supporting cancer cell survival under stress conditions.

  • Protein trafficking and secretion: If TTMP participates in protein quality control or trafficking within the ER, it might influence the secretion of growth factors, cytokines, or extracellular matrix components that shape the tumor microenvironment.

  • Therapy resistance: ER-resident proteins can contribute to therapy resistance by modulating stress responses, drug metabolism, or apoptotic signaling. TTMP might play a role in these resistance mechanisms.

Research methodologies to investigate these possibilities would include correlation of TTMP expression with cancer progression markers, gain and loss of function studies in cancer models, and analysis of TTMP expression in patient samples correlated with clinical outcomes .

How do methodological approaches for studying TTMP compare with those for recombinant tPA?

The methodological approaches for studying TTMP differ significantly from those used for recombinant tissue plasminogen activator (tPA) due to their distinct biological characteristics:

AspectTTMP Research MethodsRecombinant tPA Research Methods
Expression systemsMammalian expression systems (HEK293, CHO) focusing on intracellular localizationLarger-scale production systems like HEK293 with secretion optimization
PurificationDetergent-based membrane protein extractionAffinity chromatography from conditioned media
Functional assaysCell-based assays examining ER functionEnzymatic activity assays measuring plasminogen activation
Structural studiesChallenging due to membrane integrationMore established for secreted proteins
In vivo modelsLimited to expression analysis currentlyWell-established models for efficacy and safety testing

For recombinant tPA, production systems have been optimized to generate functionally active protein with proper post-translational modifications, as exemplified by the commercial product described in search result #4, which is expressed in HEK293 cells with a C-terminal His tag . In contrast, TTMP research remains at an earlier stage, focused on understanding basic biology rather than therapeutic application .

What experimental designs would best evaluate potential interactions between TTMP and the tPA/LRP-1 signaling axis?

To investigate potential interactions between TTMP and the tPA/LRP-1 signaling axis, researchers should consider the following experimental design strategies:

  • Co-localization studies:

    • Triple immunofluorescence for TTMP, LRP-1, and ER markers

    • Super-resolution microscopy to detect potential interactions at ER-plasma membrane contact sites

    • Live-cell imaging with differently tagged proteins to track dynamic interactions

  • Biochemical interaction assays:

    • Co-immunoprecipitation from cells expressing both proteins

    • Proximity ligation assay to detect close associations in intact cells

    • FRET or BRET analysis for direct protein-protein interactions

  • Functional impact assessment:

    • TTMP overexpression and knockdown followed by analysis of LRP-1 expression, localization, and turnover

    • Measurement of tPA-induced signaling (Akt phosphorylation, calcium flux) in cells with modified TTMP levels

    • Analysis of neutrophil migration in response to tPA after modulation of TTMP expression

  • Pathway integration analysis:

    • Phosphoproteomics to identify shared signaling nodes

    • Transcriptomics to identify genes commonly regulated by both systems

    • Metabolomics to detect common metabolic impacts

These approaches would help determine whether TTMP functionally intersects with the tPA/LRP-1 signaling axis described in the literature , potentially revealing new regulatory mechanisms in cellular responses to both TPA and tPA.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.