Recombinant Human Trace amine-associated receptor 1 (TAAR1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human TAAR1

Recombinant Human Trace Amine-Associated Receptor 1 (TAAR1) refers to the engineered human variant of the TAAR1 protein, expressed via molecular cloning and heterologous systems (e.g., E. coli, mammalian cells). This receptor is a G protein-coupled receptor (GPCR) primarily localized intracellularly, with roles in modulating monoaminergic neurotransmission, immune signaling, and psychostimulant responses. Its recombinant form enables structural, pharmacological, and functional studies critical for drug development and mechanistic insights .

Pharmacological Profile

TAAR1 exhibits species-specific ligand selectivity, with human and rodent orthologs differing in agonist potencies. Below is a comparative analysis of key ligands:

LigandHuman TAAR1 EC₅₀ (nM)Rodent TAAR1 EC₅₀ (nM)MechanismReference
β-Phenethylamine (β-PEA)371.9 (WT)High affinity (rodent)Endogenous agonist
Tyramine (TYR)1,962.7 (WT)High affinity (rodent)Endogenous agonist
Ro52633970.7 (I290Y mutant)Low affinity (rodent)Synthetic agonist
Ulotaront1.4 (I290N mutant)High affinity (rodent)Synthetic agonist
AsenapinePotent activationUnknownOff-target agonist (antipsychotic)

Key Findings:

  • Species-Specific Mutations: Substituting I290⁷·³⁹ (human threonine) with rodent residues (tyrosine/asparagine) shifts ligand selectivity. For example, I290N mutation increases ulotaront potency by >100-fold .

  • Endogenous Agonists: Trace amines (β-PEA, TYR) and dopamine act as low-potency agonists, while 3-iodothyronamine (T₁AM) is a high-potency endogenous ligand .

Functional Roles in Neurotransmission

TAAR1 modulates monoamine systems through distinct mechanisms:

FunctionMechanismReference
Dopamine RegulationSuppresses spontaneous firing of dopaminergic neurons via GIRK activation.
Transporter ModulationPKA/PKC-mediated phosphorylation of DAT, reducing dopamine reuptake.
Glutamate RegulationAstrocyte TAAR1 regulates EAAT2 (glutamate transporter) in neuroinflammation.

Behavioral Implications:

  • Methamphetamine Sensitivity: Taar1-knockout mice exhibit reduced aversive responses to methamphetamine, correlating with higher voluntary intake .

  • Antipsychotic Action: TAAR1 agonists (e.g., Ro5263397) attenuate amphetamine-induced hyperactivity, suggesting therapeutic potential in schizophrenia .

Immune System Interactions

TAAR1 influences immune responses through lymphocyte and astrocyte signaling:

RoleMechanismReference
Lymphocyte ChemotaxisTAAR1 agonists induce chemotaxis in PMN cells and T-cells.
Cytokine SecretionActivation triggers IL-4 release in T-cells and IgE secretion in B-cells.
Neuroimmune RegulationModulates EAAT2 in astrocytes, mitigating glutamate toxicity in neurodegeneration.

Therapeutic Potential

  • Drug Development: Structural insights enable design of TAAR1-selective agonists/antagonists for schizophrenia, addiction, and immune disorders.

  • Species-Specific Pharmacology: Rodent models may not accurately predict human TAAR1 responses due to divergent binding pockets .

Limitations

  • Intracellular Localization: TAAR1’s primary intracellular positioning complicates ligand access, necessitating transporter co-expression for maximal signaling .

  • Off-Target Effects: Asenapine’s activation of TAAR1 may contribute to its therapeutic or adverse effects, warranting clinical reevaluation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preferred format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing of the product is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
TAAR1; TA1; TAR1; TRAR1; Trace amine-associated receptor 1; TaR-1; Trace amine receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNW LIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID RYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNG ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS
Uniprot No.

Target Background

Function
Trace amine-associated receptor 1 (TAAR1) is a receptor for trace amines, including beta-phenylethylamine (b-PEA), p-tyramine (p-TYR), octopamine, and tryptamine, with the highest affinity for b-PEA and p-TYR. It is unresponsive to classical biogenic amines, such as epinephrine and histamine, and only partially activated by dopamine and serotonin. Trace amines are biogenic amines found in very low levels in mammalian tissues. While some trace amines have well-defined roles as neurotransmitters in invertebrates, their function as true neurotransmitters in vertebrates remains speculative. They are likely involved in a variety of physiological functions that require further investigation. The signal transduced by TAAR1 is mediated by the G(s)-class of G-proteins which activate adenylate cyclase.
Gene References Into Functions
  1. A rare heterozygous variant (c.545G>T; p.Cys182Phe) in the Trace amine associated receptor 1 gene (TAAR1 6q23.2) was identified in three affected members of a small SZ family. PMID: 28242106
  2. TAAR1 appears to be an independent predictor of breast cancer survival. PMID: 28409272
  3. Single nucleotide polymorphisms (SNPs) in human TAAR1 alter its function, leading to expressed but functional, sub-functional, and non-functional receptors. PMID: 27031617
  4. An increase in TAAR1 receptor expression coincides with lymphocyte immune activation, suggesting a potential role for TAAR1 in the generation or regulation of an immune response. PMID: 22038157
  5. Biogenic amines potently regulate blood cell functions via TAAR1 and TAAR2, opening the possibility of their specific pharmacological modulation. PMID: 23315425
  6. Methamphetamine, but not morphine, induced conditioned place preference was enhanced in TAAR1 transgenic mice. PMID: 22079347
  7. Trace amine 1 receptors (TA1R) exert an inhibitory influence on both dopaminergic and serotonergic transmission. Furthermore, MDMA (ecstasy) auto-inhibits its neurochemical and functional actions by recruiting TA1R. PMID: 22114263
  8. Data suggest that TAAR1 and D2R have functional and physical interactions that could be crucial for the modulation of the dopaminergic system by TAAR1 in vivo. PMID: 21670104
  9. This review focuses on recent studies that reveal a role for TAAR1 in the functional regulation of monoamine transporters and the neuronal regulatory mechanisms that modulate dopaminergic activity. PMID: 21073468
  10. Research indicates that TAAR1 tonically activates inwardly rectifying K(+) channels, which reduces the basal firing frequency of dopamine neurons in the ventral tegmental area. PMID: 19892733
  11. Expression of neuronal trace amine-associated receptor (Taar) mRNAs in leukocytes has been observed. PMID: 17900709
  12. A systematic evaluation of a series of beta-phenethylamines as ligands to TAAR1 has been reported. PMID: 18602830

Show More

Hide All

Database Links

HGNC: 17734

OMIM: 609333

KEGG: hsa:134864

STRING: 9606.ENSP00000275216

UniGene: Hs.375030

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in low levels in discrete regions within the central nervous system and in several peripheral tissues. Moderately expressed in stomach. Low levels in amygdala, kidney, and lung, and small intestine. Trace amounts in cerebellum, dorsal root gangli

Q&A

What are the optimal expression systems for recombinant human TAAR1?

When expressing recombinant human TAAR1, researchers must consider the challenge of achieving stable membrane expression. TAAR1 primarily signals through Gαs proteins, but establishing reliable surface expression can be difficult due to its tendency for intracellular localization. For optimal expression:

  • Use mammalian cell lines such as HEK293 with modified expression vectors that enhance membrane trafficking

  • Consider employing chimeric constructs with N-terminal tags to facilitate surface expression

  • Implement quality control measures to verify membrane localization through immunofluorescence or surface biotinylation techniques

It's important to note that species differences exist in TAAR1 pharmacology, with rat TAAR1 often showing higher affinity for trace amines compared to human TAAR1 . When establishing expression systems, these species-specific differences should be considered, especially when translating findings between model systems.

How can I validate the functionality of expressed recombinant human TAAR1?

Functional validation of recombinant human TAAR1 requires appropriate assay selection and reference compounds:

  • Implement cAMP accumulation assays as TAAR1 primarily couples to Gαs proteins

  • Use established agonists such as β-phenylethylamine and p-tyramine as positive controls

  • Include the selective antagonist EPPTB to confirm receptor specificity in functional responses

  • Establish full concentration-response curves rather than single-point measurements

When validating functionality, consider that human TAAR1 typically shows different pharmacological profiles compared to rodent orthologs. For human TAAR1, β-phenylethylamine often shows higher potency than p-tyramine, while this relationship may differ in rat TAAR1 . Functional assays should detect responses to known agonists at concentrations consistent with published literature (nanomolar to low micromolar range).

What methodological considerations are important when screening compounds for TAAR1 activity?

When screening for novel TAAR1 modulators, several methodological factors should be considered:

  • Select appropriate cell backgrounds with minimal endogenous responses to test compounds

  • Implement counter-screening to identify non-specific effects on cAMP pathways

  • Include reference compounds such as β-phenylethylamine or the clinical candidate ulotaront (SEP-363856)

  • Account for potential species differences in compound potency and efficacy

It's essential to distinguish direct TAAR1 agonism from indirect effects through other monoaminergic systems. This can be achieved by using selective antagonists like EPPTB and comparing results with TAAR1 knockout models . Additionally, screening should consider the receptor's reported constitutive activity, which may affect baseline measurements and data interpretation.

How does TAAR1 modulate dopaminergic neurotransmission in experimental models?

TAAR1 exhibits significant regulatory effects on dopaminergic systems, which can be studied through various methodological approaches:

  • Electrophysiological recordings in brain slices containing dopaminergic neurons (e.g., ventral tegmental area)

  • Fast-scan cyclic voltammetry to measure real-time dopamine release

  • Pharmacological manipulation combined with genetic models (e.g., TAAR1 knockout mice)

Evidence suggests that TAAR1 tonically activates inwardly rectifying K+ channels, which reduces the basal firing frequency of dopamine neurons in the VTA . When the selective antagonist EPPTB is applied alone, it increases the firing frequency of dopamine neurons, suggesting that TAAR1 either exhibits constitutive activity or is tonically activated by ambient levels of endogenous agonists . This tonic inhibitory effect represents an important mechanism by which TAAR1 modulates dopaminergic neurotransmission.

How do TAAR1 and dopamine D2 receptors interact, and what methods best capture this relationship?

The interaction between TAAR1 and dopamine D2 receptors represents a complex area of investigation with important implications for antipsychotic development:

  • Both acute application of the TAAR1 antagonist EPPTB and genetic deletion of TAAR1 increase the potency of dopamine at D2 receptors in dopamine neurons

  • This suggests a homeostatic feedback mechanism where TAAR1 modulates D2 receptor sensitivity

To study this interaction effectively:

  • Use electrophysiological approaches to measure D2 receptor-mediated responses in the presence and absence of TAAR1 activity

  • Implement biochemical assays to assess receptor complex formation and signaling crosstalk

  • Compare D2 receptor pharmacology between wild-type and TAAR1 knockout models

Understanding this interaction provides mechanistic insights into how TAAR1 agonists might exert antipsychotic effects without direct D2 receptor blockade, potentially offering advantages over conventional antipsychotics .

What experimental approaches can distinguish between constitutive activity and tonic activation of TAAR1?

Evidence suggests that TAAR1 may exhibit constitutive activity or be tonically activated by endogenous ligands, presenting a methodological challenge:

  • The TAAR1 antagonist EPPTB increases dopamine neuron firing when applied alone, suggesting baseline TAAR1 activity

  • This activity could represent true constitutive (ligand-independent) signaling or tonic activation by ambient trace amines

To distinguish between these possibilities:

  • Use inverse agonists versus neutral antagonists in systems with varying levels of potential endogenous agonists

  • Compare signaling in wild-type TAAR1 with constitutively inactive mutants

  • Implement experimental designs in TAAR1 knockout models to establish true baseline activity

These methodological considerations are crucial for accurately interpreting experimental results and understanding TAAR1's physiological role in regulating neuronal activity.

How can I investigate the role of TAAR1 polymorphisms in disease susceptibility and drug responses?

Approximately 200 non-synonymous and 400 synonymous single nucleotide polymorphisms (SNPs) have been identified in human TAAR1, but their functional consequences remain largely unexplored . Human genes for TAARs cluster on chromosome 6q23, within a region implicated in susceptibility to schizophrenia and bipolar disorder .

Methodological approaches to study these variants include:

  • Genotype-phenotype association studies in clinical populations

  • Functional characterization of recombinant variant receptors in cellular systems

  • Computational modeling to predict structural and functional consequences of polymorphisms

Animal studies provide supporting evidence for the relevance of TAAR1 variants in psychopathology. For instance, a naturally occurring SNP in mouse Taar1 (Taar1m1J) renders the receptor non-functional in response to methamphetamine and is associated with increased methamphetamine intake . Similar mechanisms may operate with human TAAR1 variants, potentially influencing disease susceptibility or treatment response.

What strategies can effectively evaluate TAAR1 agonists as potential therapeutics for schizophrenia?

TAAR1 has emerged as a promising therapeutic target for schizophrenia due to its ability to modulate both dopaminergic and glutamatergic systems implicated in the disorder's pathophysiology . To evaluate TAAR1 agonists for this indication:

  • Assess effects on positive symptoms through models of hyperdopaminergia

  • Evaluate impact on negative and cognitive symptoms through appropriate behavioral paradigms

  • Study glutamatergic modulation, as TAAR1 activation attenuates hypoglutamatergic activity

  • Consider translation between preclinical findings and clinical outcomes

The TAAR1 agonist ulotaront (SEP-363856) represents a promising candidate in Phase 3 clinical development for schizophrenia . Unlike traditional antipsychotics, TAAR1 agonists regulate dopaminergic systems without direct D2 receptor blockade, potentially offering efficacy with reduced side effects . Experimental designs should capture this mechanism of action while assessing effects across symptom domains.

How can I design experiments to investigate TAAR1's role in substance use disorders?

Evidence suggests that TAAR1 plays a significant role in substance use disorders, particularly methamphetamine addiction:

  • Multiple lines of evidence support the involvement of Taar1 in differences in methamphetamine intake in mice

  • TAAR1 knockout mice show increased vulnerability to ethanol addiction

To investigate this relationship methodologically:

  • Utilize genetic models with TAAR1 variants or knockouts

  • Employ self-administration paradigms with selective TAAR1 compounds

  • Examine potential interactions with other addiction-related genes, such as Oprm1 (μ-opioid receptor gene)

A notable study used CRISPR-Cas9 to test the causal role of Taar1 in methamphetamine intake, demonstrating that genetic modification of Taar1 rescued methamphetamine-related traits to levels found in methamphetamine-avoiding animals . This suggests that TAAR1 modulators might have therapeutic potential for substance use disorders.

What methods best capture TAAR1's effects on glutamatergic neurotransmission?

While TAAR1's effects on monoaminergic systems are well-documented, its modulation of glutamatergic neurotransmission is equally important but methodologically more challenging to study:

  • Electrophysiological recordings to measure AMPA and NMDA receptor-mediated currents

  • Glutamate biosensors or microdialysis to assess glutamate release in response to TAAR1 modulation

  • Behavioral assessments in hypoglutamatergic models following TAAR1 agonist treatment

TAAR1 activation has been shown to modulate glutamatergic neurotransmission and attenuate hypoglutamatergic activity , which is particularly relevant for schizophrenia where deficits in cortical glutamatergic neurotransmission are implicated in the pathophysiology . Developing methodologies to probe this mechanism could provide insights into the therapeutic potential of TAAR1 agonists beyond their effects on dopaminergic systems.

How can computational approaches advance understanding of TAAR1 structure and ligand interactions?

With the challenges of experimentally determining GPCR structures, computational approaches offer valuable insights into TAAR1:

  • Homology modeling based on related GPCRs with known crystal structures

  • Molecular docking simulations to predict ligand binding modes

  • Molecular dynamics simulations to assess receptor conformational changes upon activation

These computational studies can:

  • Predict key residues involved in ligand recognition

  • Guide medicinal chemistry efforts for developing selective TAAR1 modulators

  • Help understand species differences in pharmacology

  • Provide insights into the structural basis of constitutive activity

Results from computational studies should be validated experimentally through site-directed mutagenesis and functional assays to confirm predicted ligand-receptor interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.