Recombinant Human Trace amine-associated receptor 5 (TAAR5)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Trace Amine-Associated Receptor 5 (TAAR5) is a synthetic version of the endogenous TAAR5 protein, a G-protein-coupled receptor (GPCR) encoded by the TAAR5 gene. It is primarily expressed in skeletal muscle, limbic brain regions (e.g., amygdala, hippocampus), and the olfactory epithelium, where it detects tertiary amines like trimethylamine (TMA) . Recombinant TAAR5 is engineered for research purposes, enabling detailed studies of its ligand-binding properties, signaling mechanisms, and therapeutic potential.

Expression and Purification

Recombinant TAAR5 is typically produced in heterologous systems for functional assays:

ParameterDetails
Expression SystemE. coli (bacterial), HEK293 cells (mammalian)
TagN-terminal His-tag for purification via nickel affinity chromatography
Purity>90% (SDS-PAGE validated)
StorageLyophilized powder; store at -20°C/-80°C to preserve activity

Applications:

  • Ligand Screening: Used in BRET (Bioluminescence Resonance Energy Transfer) assays to identify antagonists .

  • Signaling Studies: Monitors cAMP production and ERK/CREB phosphorylation in response to TMA .

Ligand Specificity and Signaling

TAAR5 exhibits strict specificity for tertiary amines:

  • TMA: EC₅₀ = 116 µM (full agonist); activates cAMP and MAP kinase pathways .

  • DMEA: EC₅₀ = 169 µM (partial agonist); lower efficacy compared to TMA .

  • Antagonists: Two small-molecule antagonists (Compounds 1 and 2) inhibit TMA-induced cAMP production with submicromolar potency, blocking CREB/ERK signaling .

Behavioral and Pathophysiological Implications

  • Emotional Regulation: TAAR5 knockout (KO) mice show reduced anxiety/depressive-like behaviors, suggesting TAAR5 antagonists may treat mood disorders .

  • Motor Function: TAAR5 KO mice display improved balance and coordination, implicating TAAR5 in vestibular-motor integration .

Comparative Analysis with Murine TAAR5

FeatureHuman TAAR5Murine TAAR5
TMA SensitivityEC₅₀ = 116 µMEC₅₀ = 300 nM
Ligand ProfileTMA, DMEATMA, N-methylpiperidine
Behavioral ImpactAnxiety modulationOlfactory-driven social behavior

Therapeutic Potential

TAAR5 antagonists are being explored for:

  • Anxiety/Depression: Compounds 1 and 2 inhibit TAAR5 signaling, potentially normalizing serotonin levels .

  • Motor Disorders: Targeting TAAR5 in cerebellar circuits may address balance deficits .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery times.
Note: All of our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
In general, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us and we will prioritize developing the specified tag.
Synonyms
TAAR5; PNR; Trace amine-associated receptor 5; TaR-5; Trace amine receptor 5; hTaar5; Putative neurotransmitter receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVS YFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLT SIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLS QWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSL AGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE
Uniprot No.

Target Background

Function
Trace amine-associated receptor 5 (TAAR5) is an olfactory receptor specific for trimethylamine, a trace amine. It is also activated at a lower level by dimethylethylamine. Trimethylamine is a bacterial metabolite found in certain animal odors and is perceived by humans as a repulsive odor associated with bad breath and spoiled food. This receptor is likely mediated by the G(s)-class of G-proteins, which activate adenylate cyclase.
Gene References Into Functions
  1. Both murine and human TAAR5 (hTAAR5) exhibit significant basal activity in the Gq/11 pathway. PMID: 25706283
  2. Human TAAR5 can be activated by trimethylamine. PMID: 23393561
  3. Previous research documented TAAR expression in the brain. This study found TAAR expression exclusively in olfactory epithelial cells, indicating that each TAAR detects a unique set of amine ligands. TAARs appear to function as a family of chemosensory receptors for amines. PMID: 16878137
Database Links

HGNC: 30236

OMIM: 607405

KEGG: hsa:9038

STRING: 9606.ENSP00000258034

UniGene: Hs.248198

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed almost exclusively in skeletal muscle and selected areas of the brain, such amygdala, hippocampus, caudate nucleus, thalamus and hypothalamus. Weak expression is also find in substantia nigra.

Q&A

What is the optimal expression system for functional studies of human TAAR5?

Human TAAR5 has been successfully expressed in various recombinant systems. For functional studies, the HANA3A cell line has proven effective when co-transfected with cDNA coding for rho-tagged hTAAR5 together with Golf and RTP1S to ensure proper receptor expression . This co-expression strategy significantly enhances cell surface expression of the receptor, which is crucial for obtaining measurable receptor activation. Alternatively, the Xenopus oocyte expression system has been validated for electrophysiological measurements, where TAAR5 can be co-expressed with the cystic fibrosis transmembrane conductance regulator (CFTR) to enable measurement of inward currents upon receptor activation .

What are the validated ligands for human TAAR5?

Human TAAR5 exhibits highly selective activation by tertiary amines, primarily trimethylamine (TMA) and dimethylethylamine (DMEA). Among 42 different amines and amine-like substances tested at 100 μM concentration, only TMA (full agonist) and DMEA (partial agonist) produced significant activation . The receptor shows no appreciable activation by other tested aminic compounds including β-phenylethylamine, tyramine, serotonin, isobutylamine, N-methylpiperidine, putrescine, cyclohexylamine, and ethanolamine . This high selectivity for tertiary amines with methyl or ethyl side chains distinguishes the human receptor from its murine ortholog.

How can TAAR5 activation be measured in recombinant systems?

Two primary methods have been validated for measuring TAAR5 activation:

  • Cre-luciferase reporter gene assay: This system involves transfection of cells with TAAR5 along with Golf and RTP1S, plus a cAMP-dependent reporter gene construct (Cre-luciferase). Receptor activation leads to increased cAMP levels, resulting in luciferase expression that can be quantified . This method allows for high-throughput screening of potential ligands.

  • Electrophysiological recording in Xenopus oocytes: TAAR5 can be co-expressed with CFTR in Xenopus oocytes. Activation of TAAR5 increases cAMP levels, subsequently opening CFTR channels and generating measurable inward currents. This approach has a detection threshold of approximately 1 μM for TMA .

What are the species differences between human and mouse TAAR5?

Human and mouse TAAR5 exhibit significant differences in ligand specificity and sensitivity:

ParameterHuman TAAR5Mouse TAAR5Notes
Ligand specificityExclusively activated by tertiary amines (TMA, DMEA)Activated by tertiary amines, N-methylpiperidine, and secondary amines like dimethylamineMouse receptor shows broader ligand specificity
TMA sensitivity (EC50)116 μM940 nM (same assay conditions)Mouse receptor approximately 123-fold more sensitive
Olfactory detectionLess sensitive in recombinant systems than in vivoMore closely matches in vivo sensitivityOlfactory detection threshold for TMA in water is 8 nM

These species differences are critical considerations when designing experiments and interpreting results across model systems .

What approaches are most effective for identifying novel TAAR5 antagonists?

Recent successful approaches for TAAR5 antagonist discovery include:

  • Structure-based virtual screening: The AtomNet® deep learning neural network has been effectively applied to TAAR5 homology models for virtual screening campaigns. This approach led to the identification of two mTAAR5 antagonists with low to submicromolar activity from screening approximately 2 million compounds . Another structure-based protocol achieved a 10% hit rate, identifying three new TAAR5 antagonists .

  • Homology modeling and binding site refinement: Despite lacking an experimental structure, TAAR5 binding sites can be accurately modeled by integrating comparative sequence- and structure-based analyses of serotonin receptors with homology modeling and side-chain optimization . Key residues for the binding site include R94^2.64, D114^3.32, L203^5.43, F208^5.47, T269^6.52, D288^7.35, F287^7.34, W265^6.48, F268^6.51, I291^7.38, and Y295^7.42^ .

  • BRET-based assays: Bioluminescence resonance energy transfer assays have been successfully employed to measure cAMP production and can be utilized to screen for compounds that inhibit TMA-induced TAAR5 activation .

The combination of computational approaches with functional validation assays has yielded several novel antagonists with IC50 values in the low micromolar range (2.8-21 μM) .

How can one assess TAAR5 downstream signaling pathways?

TAAR5 downstream signaling can be assessed by monitoring:

  • cAMP production: As a G protein-coupled receptor, TAAR5 activation leads to increased cAMP production, which can be measured using BRET-based assays or reporter gene systems .

  • ERK phosphorylation: TMA (10 μM) activates ERK phosphorylation in HEK293 cells expressing rhoTAAR5, with maximum effect observed at 5 minutes post-stimulation. TAAR5 antagonists at 10 μM concentration can block this phosphorylation .

  • CREB phosphorylation: Similarly, TMA induces CREB phosphorylation with maximum effect at 15 minutes post-stimulation. TAAR5 antagonists can prevent this phosphorylation .

Methodology for assessing these pathways typically involves treating TAAR5-expressing cells with the agonist (TMA), with or without pre-incubation with antagonists, followed by cell lysis at appropriate time points and western blot analysis for phosphorylated proteins .

What factors affect the sensitivity and reproducibility of TAAR5 functional assays?

Several factors significantly impact the sensitivity and reproducibility of TAAR5 functional assays:

  • Co-expression of accessory proteins: The co-transfection of RTP1S and Golf significantly enhances cell-surface expression of TAAR5 and assay sensitivity . Optimization of expression conditions for each receptor system may further improve performance.

  • Expression system selection: Recombinant systems may show lower sensitivity than receptors expressed in vivo in olfactory sensory neurons (OSNs). For instance, the olfactory detection threshold for TMA in water is 8 nM, whereas even the sensitive murine TAAR5 is not activated by such low concentrations in recombinant systems .

  • Normalization methods: Responses in luciferase assays should be normalized to the response to forskolin (10 μM), while electrophysiological recordings in Xenopus oocytes should be normalized to IBMX-induced currents . This normalization allows for more consistent comparisons across experiments.

  • Experimental replication: Data should be collected from multiple independent experiments (2-10) performed in duplicate to account for variability in receptor expression and assay conditions .

How can one investigate the non-olfactory functions of TAAR5 in brain physiology?

Recent evidence indicates that TAAR5 has significant non-olfactory functions in the brain, particularly in limbic regions. Approaches to investigate these functions include:

  • Genetic models: TAAR5 knockout mice have been instrumental in revealing roles in cognitive performance and emotional behavior. These mice show generally better performance in temporal decision-making tasks with a reduced number of errors and a greater rate of improvement compared to wild-type littermates .

  • Pharmacological intervention: Novel TAAR5 antagonists can be administered to investigate receptor function in vivo. These compounds should be characterized for drug-like properties, including brain penetration .

  • Neurochemical analysis: Given TAAR5's role in regulating brain serotonin function, microdialysis or fast-scan cyclic voltammetry can be used to measure neurotransmitter levels in relevant brain regions following genetic deletion or pharmacological manipulation of TAAR5 .

  • Behavioral paradigms: Specific cognitive and emotional behavior tests (e.g., temporal decision-making tasks, anxiety tests, depression models) can reveal the functional consequences of TAAR5 modulation .

How can surface expression of human TAAR5 be optimized in recombinant systems?

Optimizing surface expression of human TAAR5 presents several challenges. Successful approaches include:

  • Co-expression of chaperone proteins: The receptor transport protein RTP1S significantly enhances trafficking of TAAR5 to the cell surface . Immunocytochemical detection of the extracellular N-terminal rho-epitope tag in fixed cells and live-cell staining can confirm successful surface expression.

  • G protein engineering: Co-expression with Golf enhances functional coupling and signal transduction of the receptor . This approach improves both surface expression and signaling capacity.

  • Cell line selection: The HANA3A cell line has been demonstrated to support functional expression of human TAAR5 when properly supplemented with accessory proteins . This cell line may provide advantages over standard HEK293 cells for certain applications.

  • Expression vector optimization: Codon optimization and selection of appropriate promoters can significantly improve expression levels of difficult GPCRs like TAAR5.

What methods can address the discrepancy between in vitro and in vivo sensitivity of TAAR5?

The significant discrepancy between in vitro and in vivo sensitivity of TAAR5 (recombinant systems showing EC50 values of 116 μM for human TAAR5, while olfactory detection threshold is approximately 8 nM) poses challenges for translational research . Several approaches can address this issue:

  • Native tissue preparations: Working with isolated olfactory sensory neurons or membrane preparations from native tissues expressing TAAR5 may provide more physiologically relevant sensitivity measurements.

  • Improved expression systems: Further optimization of expression conditions, including testing different combinations of accessory proteins beyond RTP1S and Golf, may enhance receptor sensitivity in recombinant systems.

  • Signal amplification: Implementing more sensitive detection methods or signal amplification strategies in recombinant systems could improve detection of responses to lower ligand concentrations.

  • Consideration of physiological context: Acknowledging the limitations of recombinant systems and interpreting data with appropriate caution, particularly when extrapolating to in vivo settings.

What are the therapeutic implications of TAAR5 modulation for neuropsychiatric disorders?

Emerging evidence suggests significant therapeutic potential for TAAR5 modulation:

  • Anxiety and depression: TAAR5 is expressed in major limbic brain areas and regulates emotional behaviors . TAAR5 antagonism represents a novel therapeutic strategy for anxiety and depression, with knockout mice showing improved cognitive performance .

  • Neurodegeneration: TAAR5 is involved in adult neurogenesis, suggesting potential applications in neurodegenerative conditions . Further research is needed to characterize its specific role in neuronal health and regeneration.

  • Cognitive enhancement: Given the improved performance of TAAR5 knockout mice in certain cognitive tasks, TAAR5 antagonists could potentially enhance specific cognitive domains .

The development of potent and selective TAAR5 antagonists with drug-like properties represents a promising avenue for investigating these therapeutic applications .

How can computational approaches enhance TAAR5 drug discovery efforts?

Computational methods have already demonstrated significant value in TAAR5 drug discovery:

  • Deep learning models: The AtomNet® deep learning neural network has successfully identified novel TAAR5 ligands from large compound libraries . Further refinement of these models with additional experimental data could improve hit rates.

  • Structure-based virtual screening: Despite lacking an experimental structure, homology modeling combined with binding site refinement has enabled successful virtual screening campaigns with hit rates of 10% . Integration of new structural information, as it becomes available, will enhance these models.

  • Pharmacophore modeling: Analysis of the growing number of known TAAR5 ligands could enable development of pharmacophore models to guide design of more potent and selective compounds.

  • Machine learning for ADME/Tox prediction: Integration of machine learning approaches to predict absorption, distribution, metabolism, excretion, and toxicity properties could accelerate development of leads with favorable drug-like characteristics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.