Recombinant Human Trace amine-associated receptor 8 (TAAR8)

Shipped with Ice Packs
In Stock

Description

Research Applications

Recombinant TAAR8 is utilized in:

  • Ligand-Binding Studies: Identifying endogenous or synthetic agonists/antagonists .

  • Structural Biology: Mapping transmembrane domain interactions .

  • Disease Models: Investigating links to schizophrenia, bipolar disorder, and migraines .

Available Recombinant TAAR8 Products

Product IDSourceTagPurityApplications
ABIN1330539Wheat germNone>70%WB, AP, ELISA
ABIN3117179Cell-free (AliCE®)Strep Tag>70-80%WB, ELISA, functional assays

Key Research Findings

  • Genetic Associations: The TAAR8 locus on chromosome 6 is linked to psychiatric disorders, though genome-wide significance remains unconfirmed .

  • Neuromodulatory Role: TAAR8 may indirectly regulate dopamine and serotonin pathways via trace amine interactions .

  • In Vitro Activity: Confirmed constitutive Gi/o signaling in transfected cells, suggesting intrinsic receptor activity .

Challenges and Future Directions

  • Ligand Identification: No high-affinity ligands validated to date, necessitating further screening .

  • Structural Resolution: Lack of crystallographic data limits mechanistic insights .

  • Therapeutic Potential: TAAR8 modulation could offer novel pathways for neuropsychiatric drug development .

References

  • Structural data:

  • Functional studies:

  • Genetic associations:

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate your preference when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAAR8; GPR102; TA5; TAR5; TRAR5; Trace amine-associated receptor 8; TaR-8; Trace amine receptor 8; G-protein coupled receptor 102; Trace amine receptor 5; TaR-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MTSNFSQPVVQLCYEDVNGSCIETPYSPGSRVILYTAFSFGSLLAVFGNLLVMTSVLHFK QLHSPTNFLIASLACADFLVGVTVMLFSMVRTVESCWYFGAKFCTLHSCCDVAFCYSSVL HLCFICIDRYIVVTDPLVYATKFTVSVSGICISVSWILPLTYSGAVFYTGVNDDGLEELV SALNCVGGCQIIVSQGWVLIDFLLFFIPTLVMIILYSKIFLIAKQQAIKIETTSSKVESS SESYKIRVAKRERKAAKTLGVTVLAFVISWLPYTVDILIDAFMGFLTPAYIYEICCWSAY YNSAMNPLIYALFYPWFRKAIKLILSGDVLKASSSTISLFLE
Uniprot No.

Target Background

Function
TAAR8 is an orphan receptor that may function as a receptor for trace amines. Trace amines are biogenic amines present in very low concentrations in mammalian tissues. While some trace amines have well-defined roles as neurotransmitters in invertebrates, their function as true neurotransmitters in vertebrates remains under investigation. Trace amines are likely involved in various physiological functions that require further elucidation.
Gene References Into Functions
  1. This study is the first to confirm basal Gi/o signaling activity for TAAR8. PMID: 25391046
  2. Previous research reported TAAR expression in the brain. This publication found TAAR expression exclusively in olfactory epithelial cells and that each TAAR detects a unique set of amine ligands. TAARs appear to function as a family of chemosensory receptors for amines. PMID: 16878137
Database Links

HGNC: 14964

OMIM: 606927

KEGG: hsa:83551

STRING: 9606.ENSP00000275200

UniGene: Hs.350571

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in kidney and amygdala. Not expressed in other tissues or brain regions tested.

Q&A

What is the expression profile of human TAAR8 in different tissues?

Human TAAR8 expression appears to be extremely limited across tissues, with expression levels often at or near detection limits in standard qPCR protocols. Research indicates that while TAAR8 transcripts can be detected in some samples, the expression pattern is inconsistent between biological replicates.

In murine models (specifically examining Taar8b), expression was evaluated across multiple tissue samples with a 50-cycle qPCR amplification protocol. Detectable Ct values (below 50) were observed in only 24 of 101 individual tissue samples analyzed. Even in these positive cases, the expression was described as "at most marginal and close to the detection limit." Notably, Taar8b transcripts were not detected in thyroid tissue via qPCR .

This low expression profile suggests that functional studies may require recombinant overexpression systems to achieve sufficient receptor levels for reliable detection and analysis.

What are the basic structural features of human TAAR8?

TAAR8, like other members of the trace amine-associated receptor superfamily, belongs to the G protein-coupled receptor (GPCR) family. The basic structural framework includes:

  • Seven transmembrane helices that span the cell membrane

  • An extracellular N-terminus region

  • An intracellular C-terminus domain

  • Three extracellular loops and three intracellular loops connecting the transmembrane regions

This architectural arrangement is critical for the receptor's function in sensing and transducing signals from extracellular ligands to intracellular signaling pathways. The structural configuration allows TAAR8 to function as a cellular receptor that facilitates signal transduction across the plasma membrane .

While detailed crystal or cryo-EM structures specific to TAAR8 are not presented in the available research, the receptor shares the common structural elements of the TAAR family, which enables its function as a chemosensor in various physiological processes.

What G protein coupling mechanisms are associated with TAAR8?

TAAR8 primarily couples to inhibitory G proteins (Gi/o), unlike some other members of the TAAR family that may couple to stimulatory G proteins. This coupling mechanism has significant implications for the receptor's downstream signaling effects.

When activated, TAAR8 initiates a signal transduction cascade through its associated Gi protein, which typically results in:

  • Inhibition of adenylate cyclase activity

  • Reduction in cellular cyclic AMP (cAMP) production from ATP

  • Subsequent downregulation of protein kinase A (PKA) activity

Experimental evidence for this coupling mechanism comes from functional studies where cells expressing either human TAAR8 or murine Taar8b showed significant reduction in forskolin-stimulated cAMP levels. Specifically, cAMP levels were reduced by 58% (human TAAR8) and 78% (murine Taar8b) compared to forskolin-stimulated mock-transfected cells .

The Gi/o coupling was further confirmed through pertussis toxin (PTX) experiments. PTX, which catalyzes ADP-ribosylation of Gi/o proteins and prevents them from interacting with GPCRs, reversed the inhibitory effect on cAMP accumulation, restoring levels to those of mock-transfected cells under forskolin stimulation .

What experimental approaches are recommended for measuring TAAR8 cell surface expression?

For reliable measurement of TAAR8 cell surface expression, the enzyme-linked immunosorbent assay (ELISA) methodology has been demonstrated to be effective. Research using N-terminally HA-tagged receptor constructs has successfully quantified TAAR8 surface expression in heterologous expression systems.

Methodology details:

  • Generate an N-terminally HA-tagged TAAR8 construct for transfection

  • Express the construct in an appropriate cell line (COS-7 cells have been validated)

  • Perform cell-surface ELISA using anti-HA antibodies without permeabilization

  • Include appropriate controls:

    • Empty vector (mock) as negative control

    • Well-expressed GPCR (e.g., human β2-adrenergic receptor) as positive control

    • Compare readings as fold over mock transfection

Using this approach, both human TAAR8 and murine Taar8b demonstrated measurable, albeit low, robust cell surface expression compared to empty vector controls. This suggests that while the receptor does reach the cell surface, its expression levels are modest compared to some other GPCRs .

How can researchers effectively measure TAAR8-mediated signaling?

Given TAAR8's coupling to Gi/o proteins, cAMP measurements under both basal and stimulated conditions are the primary approach for assessing receptor activity. A comprehensive experimental design should include:

For Gi/o signaling assessment:

  • Measure basal cAMP levels in cells expressing TAAR8 versus mock-transfected cells

  • Pre-stimulate cells with forskolin (to activate adenylyl cyclase) to observe inhibitory effects

  • Include pertussis toxin (PTX) treatment to confirm Gi/o involvement

  • Test candidate ligands against appropriate controls

Experimental details from published protocols:

  • Cells transiently expressing TAAR8 typically show lower cAMP accumulation than mock-transfected cells

  • Forskolin pre-stimulation (to elevate cAMP) allows better visualization of the inhibitory effect

  • PTX pre-incubation should reverse the inhibitory effect if Gi/o coupling is involved

Additional signaling pathways:
While Gi/o coupling appears primary, comprehensive characterization should include assessment of other potential signaling pathways:

Signaling PathwayMeasurement MethodBasal Activity (TAAR8)Ligand Stimulated
IP3-lucLuciferase reporter1.6 ± 0.1 fold over basal mock1.1 ± 0.2 (3-T1AM), 1.1 ± 0.2 (PEA)
RhoA-lucLuciferase reporter1.2 ± 0.1 fold over basal mock1.5 ± 0.3 (3-T1AM), 1.2 ± 0.1 (PEA)

These measurements indicate modest basal activity in IP3 and RhoA signaling pathways with limited ligand-induced effects .

What are the key considerations when designing ligand screening assays for TAAR8?

When designing ligand screening assays for TAAR8, several critical factors should be considered to ensure reliable and reproducible results:

  • Selection of appropriate cellular background:

    • HEK293 or COS-7 cells have been successfully used for TAAR8 expression

    • Consider endogenous expression of related receptors or signaling components

    • Evaluate potential cross-talk with endogenous signaling pathways

  • Signal detection methodology:

    • Given TAAR8's Gi/o coupling, assays should focus on detecting decreases in cAMP

    • Consider using forskolin pre-stimulation to raise basal cAMP levels

    • ELISA-based, FRET-based, or luminescence-based cAMP detection systems are suitable options

  • Controls for assay validation:

    • Include positive controls (known GPCR agonists for related receptors)

    • Use pertussis toxin to confirm Gi/o involvement

    • Include concentration-response curves to determine potency parameters

  • Potential candidate ligands:

    • Biogenic amines (cadaverine, putrescine) have been identified as TAAR8 ligands

    • β-phenylethylamine (PEA) and 3-T1AM have been tested but showed limited efficacy

    • Consider structural analogs of known trace amines

  • Secondary assay considerations:

    • Evaluate effects on downstream pathways (IP3, RhoA)

    • Consider functional assays related to cell migration or cytoskeletal reorganization

    • Assess receptor internalization or desensitization properties

How does TAAR8 mediate migrasome formation in response to cadaverine?

TAAR8 has been identified as a key mediator of cadaverine-induced migrasome formation in retinal pigment epithelial (RPE) cells. Migrasomes are recently discovered cellular organelles that form vesicle-like structures on the retraction fibers of migrating cells and are involved in intercellular communication.

Mechanistic pathway:

  • Cadaverine, a biogenic amine, binds to TAAR8 receptors on the cell surface

  • TAAR8 activation leads to inhibition of adenylate cyclase through its associated Gi protein

  • Reduced cAMP production results in decreased protein kinase A (PKA) activity

  • Decreased PKA activity affects Rac1 GTPase regulation (PKA normally phosphorylates and inactivates Rac1)

  • Altered Rac1 regulation influences actin cytoskeleton dynamics

  • These cytoskeletal changes promote migrasome formation on retraction fibers

Experimental evidence:

  • Cells treated with cadaverine showed significantly increased migrasome formation compared to untreated cells

  • TAAR8 knockdown inhibited the cadaverine-induced increase in migrasomes

  • In TAAR8-silenced cells, the number of migrasomes per cell, migrasome diameter, and percentage of migrasome-containing cells were all decreased compared to cadaverine-treated control cells

  • Putrescine, another biogenic amine structurally related to cadaverine, also increased migrasome formation through a similar mechanism

This research identifies TAAR8 as the target receptor for cadaverine in the regulation of migrasome biogenesis, establishing a novel role for this receptor in cellular processes beyond conventional neurotransmitter signaling.

What is the relationship between TAAR8 activity and cell migration?

TAAR8 activation plays a significant role in regulating cell migration through its effects on cytoskeletal dynamics. Research indicates that TAAR8 signaling influences cellular migration through multiple mechanisms:

  • PKA-mediated regulation of cytoskeletal dynamics:

    • TAAR8 activation leads to reduced cAMP levels and decreased PKA activity

    • Downregulation of PKA activity influences the phosphorylation status of cytoskeletal regulators

    • These changes alter actin polymerization at the cell front, affecting cell motility

  • Rac1 GTPase regulation:

    • PKA can phosphorylate and inactivate Rac1 GTPase, a key regulator of actin cytoskeleton dynamics

    • Reduced PKA activity following TAAR8 activation may lead to increased Rac1 activity

    • Altered Rac1 regulation influences lamellipodial formation and cell protrusion

  • Formation of retraction fibers:

    • TAAR8 activation by cadaverine induces significant fiber retraction

    • These retraction fibers serve as substrates for migrasome formation

    • The dynamics of retraction fiber formation and migrasome biogenesis are interlinked processes

The experimental evidence from RPE cells treated with cadaverine demonstrates that TAAR8 signaling pathways directly influence cellular migration machinery. Specifically, cells treated with cadaverine exhibited altered migratory behavior associated with changes in retraction fiber dynamics and migrasome formation .

This connection between TAAR8 and cell migration opens potential research avenues for understanding cellular movement in both physiological and pathological contexts.

How does TAAR8 differ from other TAAR family members in signaling mechanisms?

TAAR8 exhibits distinct signaling characteristics compared to other members of the trace amine-associated receptor family, particularly TAAR1, which is the most extensively studied:

FeatureTAAR8TAAR1
Primary G-protein couplingGi/o (inhibitory)Gs (stimulatory)
Effect on cAMPDecreaseIncrease
Constitutive activityStrong constitutive Gi/o activity observedModerate constitutive activity reported
Known ligandsCadaverine, putrescineβ-phenethylamine, tyramine, amphetamines
Cellular responseMigrasome formation, altered cell migrationModulation of monoaminergic neurotransmission

While TAAR1 primarily signals through Gs to stimulate cAMP production, TAAR8 couples to Gi/o proteins, leading to cAMP reduction. This fundamental difference in signaling mechanism results in distinct downstream effects and cellular responses .

Experimental evidence shows that unlike TAAR1, which responds to β-phenethylamine (PEA) with increased cAMP production, TAAR8 does not show significant cAMP elevation in response to PEA or 3-T1AM. Instead, TAAR8 exhibits robust constitutive Gi/o activity, as demonstrated by the significant reduction in forskolin-stimulated cAMP levels (58% for human TAAR8) .

This signaling divergence suggests different physiological roles for these receptors, with TAAR1 functioning as a key modulator of monoaminergic neurotransmission and psychostimulant action, while TAAR8 appears more involved in processes related to cell migration and intercellular communication through migrasome regulation.

What structural features distinguish TAAR8 from other monoaminergic receptors?

While detailed structural information specific to TAAR8 is limited compared to some other GPCRs, several distinguishing features can be identified through comparative analysis with related receptors:

  • Transmembrane domain organization:

    • TAAR8, like other TAARs, belongs to the rhodopsin-like family of GPCRs (Class A)

    • The arrangement of the seven transmembrane helices creates a binding pocket with specific properties for recognizing biogenic amines

  • Ligand binding site characteristics:

    • TAAR8 shows preference for diamines like cadaverine and putrescine

    • This differs from TAAR1, which binds monoamines like β-phenethylamine and tyramine

    • The binding pocket likely contains distinct residues that accommodate the different chemical structures of diamines versus monoamines

  • G protein coupling interface:

    • The intracellular loops (particularly ICL2 and ICL3) and C-terminus likely contain structural elements that favor Gi/o interaction

    • This differs from TAAR1, which primarily couples to Gs

    • Key residues in these regions determine G protein selectivity

  • Extracellular domain:

    • The N-terminus and extracellular loops define the entry path for ligands

    • These regions likely contain structural elements that contribute to TAAR8's ligand selectivity profile

While specific structural studies (such as crystal structures or cryo-EM) of TAAR8 were not presented in the search results, understanding of related GPCRs suggests that these structural differences underlie the functional divergence of TAAR8 from other monoaminergic receptors. More detailed structural insights into TAAR8 would likely emerge from future studies utilizing techniques similar to those that have revealed the structure of TAAR1 in complex with Gαs heterotrimer .

What are the challenges in developing specific ligands for TAAR8?

Developing specific ligands for TAAR8 presents several significant challenges that researchers must address:

  • Limited structural information:

    • Unlike TAAR1, which has been structurally characterized through cryo-EM , detailed structural information for TAAR8 is still lacking

    • The absence of high-resolution structures hampers structure-based drug design approaches

  • Overlapping ligand specificity within the TAAR family:

    • Many trace amines and biogenic amines interact with multiple TAAR subtypes

    • Achieving selectivity for TAAR8 over other family members requires detailed understanding of subtype-specific binding pocket features

  • Low expression levels and surface localization:

    • TAAR8 shows limited cell surface expression even in heterologous expression systems

    • Low receptor density complicates ligand screening and characterization efforts

  • Complex signaling profile:

    • TAAR8 exhibits constitutive Gi/o activity

    • Distinguishing between ligand-induced effects and modulation of constitutive activity presents methodological challenges

    • Potential involvement in multiple signaling pathways (IP3, RhoA) adds complexity to functional assessment

  • Species differences:

    • Significant pharmacological differences between rodent and human TAAR orthologs have been observed for TAAR1

    • Similar species differences may exist for TAAR8, complicating translation between preclinical models and human applications

Despite these challenges, the emerging roles of TAAR8 in processes like migrasome formation suggest potential value in developing selective ligands. Successful approaches might include:

  • Virtual screening using homology models based on related GPCR structures

  • High-throughput screening of diverse chemical libraries

  • Focused medicinal chemistry optimization of known ligands like cadaverine and putrescine

  • Development of allosteric modulators that target unique regions of TAAR8

How can advanced imaging techniques enhance our understanding of TAAR8 function?

Advanced imaging techniques offer powerful approaches to elucidate TAAR8 function at multiple levels, from molecular interactions to cellular processes:

  • Fluorescence microscopy for tracking receptor localization:

    • GFP-tagged TAAR8 constructs can reveal subcellular localization patterns

    • Live-cell imaging can track receptor trafficking and internalization dynamics

    • Techniques like TIRF microscopy can provide detailed information about surface expression

  • Super-resolution microscopy for nanoscale organization:

    • STORM, PALM, or STED microscopy can resolve TAAR8 distribution beyond the diffraction limit

    • These approaches can reveal potential clustering or organization in membrane microdomains

    • Multicolor super-resolution can identify colocalization with signaling partners

  • FRET-based approaches for protein-protein interactions:

    • FRET sensors can detect TAAR8 interactions with G proteins and other signaling components

    • Conformational changes associated with receptor activation can be monitored

    • These techniques allow real-time visualization of signaling events in living cells

  • Advanced imaging for migrasome visualization:

    • The use of GFP-tetraspanin4 (GFP-TSPAN4) expression has been validated for observing migrasomes

    • This approach enables identification of compounds that regulate migrasome activity in retinal pigment epithelial cells

    • Combined with TAAR8 visualization, this can directly link receptor activity to migrasome dynamics

  • Correlative light and electron microscopy (CLEM):

    • CLEM approaches can bridge the resolution gap between fluorescence and electron microscopy

    • This allows visualization of ultrastructural details of migrasomes while maintaining molecular specificity

    • Critical for understanding the physical interaction between TAAR8 and migrasome components

Implementation of these advanced imaging techniques would significantly enhance our understanding of TAAR8's functional role in processes like migrasome formation and cell migration. The development of RPE cell lines overexpressing GFP-TSPAN4 represents a valuable tool for identifying and validating chemicals and target proteins involved in migrasome formation mechanisms .

What are the potential therapeutic applications of targeting TAAR8?

While current therapeutic research in the TAAR family has primarily focused on TAAR1 for neuropsychiatric conditions, emerging understanding of TAAR8's biological functions suggests several potential therapeutic applications:

  • Disorders of cell migration and adhesion:

    • Given TAAR8's role in regulating cell migration through cytoskeletal dynamics, selective modulators could potentially address disorders characterized by aberrant cell migration

    • Applications might include certain developmental disorders, wound healing, or metastatic progression

  • Retinal disorders:

    • The demonstration of TAAR8 function in retinal pigment epithelial (RPE) cells suggests potential relevance to retinal pathologies

    • TAAR8 modulators might influence RPE cell migration, which is critical in conditions like age-related macular degeneration

    • Understanding migrasome function in retinal homeostasis could open new therapeutic avenues

  • Immune cell regulation:

    • If TAAR8-mediated migrasome formation extends to immune cells, this pathway might influence immune cell communication

    • Potential applications could include inflammatory conditions or immune regulation disorders

  • Neurodevelopmental considerations:

    • While less well-characterized than TAAR1's role in the CNS, potential TAAR8 expression in neural cells might suggest applications in neurodevelopmental processes

    • This area requires further research to establish clear therapeutic potential

Unlike TAAR1, which has advanced to clinical trials with compounds like ulotaront and ralmitaront for schizophrenia and other neuropsychiatric conditions, TAAR8-targeted therapeutics remain at a conceptual stage . Development would require:

  • Deeper understanding of TAAR8 distribution and function across tissues

  • Identification of selective agonists, antagonists, or allosteric modulators

  • Validation in appropriate disease models

  • Careful consideration of potential off-target effects on other TAAR family members

The emerging role of TAAR8 in fundamental cellular processes like migrasome formation suggests that its therapeutic potential may extend beyond traditional neuropharmacological applications that have been the focus for TAAR1-targeted therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.