Recombinant Human Translocase of inner mitochondrial membrane domain-containing protein 1 (TIMMDC1)

Shipped with Ice Packs
In Stock

Description

Production Systems and Recombinant Forms

Recombinant TIMMDC1 is produced using diverse host systems to optimize yield, solubility, and post-translational modifications. Key methods include:

Host SystemExpression VectorPurification MethodApplicationsSource
YeastYeast expression vectorAffinity chromatographyStructural studies
E. coliBacterial plasmidsNi-NTA or His-tag purificationHigh-throughput screening
BaculovirusViral vectorsSize-exclusion chromatographyMammalian-like glycosylation
Mammalian CellsLentiviral vectorsIon-exchange chromatographyFunctional assays in human cells

Key Notes:

  • Yeast and E. coli systems prioritize cost-efficiency and scalability .

  • Mammalian cells are preferred for studying native interactions with mitochondrial complexes .

Functional Roles in Mitochondrial Complex I Assembly

TIMMDC1 is indispensable for the biogenesis of Complex I, the largest enzyme in the electron transport chain. Recombinant TIMMDC1 has been used to elucidate its mechanisms:

RoleMechanismResearch FindingsSource
Membrane Arm AssemblyAssociates with MCIA complex to stabilize ND1 subunit integrationDepletion reduces Complex I activity
Subunit StabilityChaperones core subunits (e.g., ND1, ND6) during maturationKnockdown causes subunit degradation
Mitochondrial RespirationRegulates ATP production via Complex I optimizationTIMMDC1-deficient cells show impaired OCR

Disease Relevance:

  • Frameshift mutations (e.g., c.597-1340A>G) disrupt splicing, leading to TIMMDC1 deficiency and Complex I dysfunction .

  • Therapeutic Applications: Antisense oligonucleotides (SSOs) restore splicing and Complex I function in patient-derived fibroblasts .

Mitochondrial Disorders

TIMMDC1 mutations cause severe neurodevelopmental and metabolic disorders:

Mutation TypeClinical FeaturesReferences
c.597-1340A>GFailure to thrive, hypotonia, epilepsy, death by age 3
Compound HeterozygousRetardation, peripheral neuropathy, drug-resistant epilepsy

Cancer Biology

High TIMMDC1 expression correlates with metastasis, while its depletion suppresses tumor growth:

Cancer TypeEffect of TIMMDC1 KnockdownMechanismSource
GastricReduced proliferation, migrationInhibits Complex I activity and AKT/β-catenin signaling
LungAttenuated metastasisDownregulates PTEN, TIMP3, COL3A1

Diagnostic and Therapeutic Tools

  • SSO Therapy: Restores TIMMDC1 expression in patient cells, offering a potential treatment for lethal neurologic disorders .

  • Biomarker Potential: TIMMDC1 expression levels may predict metastasis in gastric/lung cancers .

Unresolved Questions

  1. Regulatory Mechanisms: How TIMMDC1 interacts with other assembly factors (e.g., NDUFAF1).

  2. Cancer Metabolism: Dual role in mitochondrial respiration and glycolysis .

  3. Splice-Correcting Therapies: Efficacy of SSOs in preclinical models.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
TIMMDC1; C3orf1; UNQ247/PRO284; Complex I assembly factor TIMMDC1, mitochondrial; Protein M5-14; Translocase of inner mitochondrial membrane domain-containing protein 1; TIMM domain containing-protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TIMMDC1
Target Protein Sequence
MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRE LFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAV QSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFR INVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRL QVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD
Uniprot No.

Target Background

Function
TIMMDC1 (Translocase of inner mitochondrial membrane domain-containing protein 1) functions as a chaperone protein essential for the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). It plays a crucial role in constructing the membrane arm of complex I.
Gene References Into Functions
  1. Depletion of C3orf1 (the gene encoding TIMMDC1) in 95D cells led to upregulation of cell-cycle arrest genes such as CCNG2 and PTEN, as well as genes involved in inhibiting cell migration, such as TIMP3 and COL3A1. PMID: 25391042
  2. Quantitative proteomics studies have demonstrated the involvement of TIMMDC1 in the assembly of both membrane-embedded and soluble arms of complex I. PMID: 24344204
Database Links

HGNC: 1321

OMIM: 615534

KEGG: hsa:51300

STRING: 9606.ENSP00000418803

UniGene: Hs.477287

Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Tissue Specificity
Generalized expression enhanced in heart and skeletal muscle.

Q&A

What is the basic structure of the TIMMDC1 protein?

TIMMDC1 is a 32.2 kDa protein composed of 285 amino acids that functions as a multipass mitochondrial inner membrane protein. The protein contains four transmembrane domains, with both N-terminal and C-terminal extensions localized in the mitochondrial matrix. TIMMDC1 is predicted to be a member of the 4-pass transmembrane protein family of TIM17-TIM22-TIM23, with a topology analogous to TIMM23 . The protein belongs to the Tim17/Tim22/Tim23 family, with generalized expression that is enhanced in heart and skeletal muscle tissues . The structural configuration of TIMMDC1 is essential for its ability to interact with other complex I assembly factors and subunits.

What is the primary function of TIMMDC1 in mitochondria?

TIMMDC1 functions as a chaperone protein specifically involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Its primary role is participating in constructing the membrane arm of complex I . Complex I is the largest complex in the electron transport chain and is responsible for coupling electron transfer to the release of protons into the mitochondrial inner membrane space, which ultimately promotes ATP production through ATP synthase . TIMMDC1's role in complex I assembly is critical for maintaining proper mitochondrial function and cellular energy production.

How is the TIMMDC1 gene organized and where is it located?

The TIMMDC1 gene (also known as C3orf1) is located on the q arm of chromosome 3 in position 13.33 and spans 25,760 base pairs. The gene structure includes 7 exons that encode the full-length protein . This genomic organization is important for understanding the potential impact of mutations, particularly intronic variants that may affect splicing patterns. The gene's alternative names include C3orf1, UNQ247/PRO284, Protein M5-14, and TIMM domain containing-protein 1 .

What disease conditions are associated with TIMMDC1 mutations?

Mutations in TIMMDC1 are associated with mitochondrial complex I deficiency, nuclear type 31 (MC1DN31). This condition is part of a broader group of mitochondrial disorders characterized by defective oxidative phosphorylation that collectively affects approximately 1 in 5,000-10,000 live births . The transmission pattern of MC1DN31 is consistent with autosomal recessive inheritance. Clinical manifestations range in severity from lethal neonatal disease to adult-onset neurodegenerative disorders. Specific phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease .

What is known about the deep intronic c.597-1340A>G variant in TIMMDC1?

The deep intronic variant TIMMDC1 c.597-1340A>G has been identified as pathogenic and is present in the gnomAD database with a frequency of approximately 1/5000 . This variant functions as a splicing enhancer, causing aberrant splicing that leads to the insertion of an 80 bp, or to a lesser extent, a 98 bp "poison exon" between Exon 5 and Exon 6 . This aberrant splicing results in almost complete loss of TIMMDC1 protein and compromised mitochondrial complex I function. RNA analysis shows significantly higher TIMMDC1 mRNA read density for the poison exon in affected individuals homozygous for the intronic variant (average 89.4%) compared to heterozygous parents (average 14.9%) and unrelated homozygous healthy controls (1.9%) .

What is the relationship between TIMMDC1 and cancer progression?

High expression of TIMMDC1 has been associated with the metastasis of lung carcinoma cells. Research has shown that depletion of the protein inhibits growth and migration of 95D lung carcinoma cells . Additionally, depletion of TIMMDC1 has been demonstrated to affect the regulation of apoptosis, the cell cycle, and cell migration . These findings suggest that TIMMDC1 may play roles beyond its function in mitochondrial complex I assembly, potentially influencing cellular processes relevant to cancer progression.

What methods are effective for studying TIMMDC1 protein interactions?

Interaction proteomics has proven effective for interrogating the molecular associations of TIMMDC1. Research has employed affinity purification coupled with mass spectrometry (AP-MS) to identify protein-protein interactions involving TIMMDC1 . In one study, proteins were eluted with HA peptide following lysis and immunoprecipitation using anti-HA beads. After trichloroacetic acid precipitation and trypsinization, samples were analyzed using a Thermo LTQ mass spectrometer . This approach has revealed that TIMMDC1 reciprocally associates with multiple members of the MCIA (ECSIT-TMEM126B-ACAD9-NDUFAF1) complex as well as core complex I subunits . For researchers studying TIMMDC1, these interaction proteomics approaches are valuable for understanding its functional associations.

How can TIMMDC1 knockdown experiments be designed effectively?

For knockdown experiments targeting TIMMDC1, both siRNA and shRNA approaches have been validated. Published siRNA sequences include TIMMDC1 siRNA_1 (5′-GAAGUACUCUGGUGAGACU-3′) and TIMMDC1 siRNA_2 (5′-CUAGAAACCCUUCAGUAAU-3′). Validated shRNA sequences include TIMMDC1 shRNA_1 (5′-CACGGGAAGTCTTTTTAGGATA-3′) and TIMMDC1 shRNA_2 (5′-TTCGCAAAAGATTAAAGTTGAA-3′) . Following knockdown, researchers should assess both RNA and protein levels to confirm depletion. Functional consequences of TIMMDC1 depletion can be evaluated by measuring complex I activity, cellular respiration, and analyzing the formation of complex I subcomplexes using techniques such as blue native PAGE .

What techniques are useful for analyzing the impact of TIMMDC1 on complex I assembly?

The coupling of stable isotopic labeling by amino acids in culture (SILAC) with size-based fractionation of mitochondria from cells with or without TIMMDC1 provides a quantitative view of complex I assembly and intermediates . This approach has revealed that TIMMDC1 depletion leads to the accumulation of complex I subcomplexes characteristic of defects in the MCIA complex. Additional techniques for studying TIMMDC1's role in complex I assembly include blue native polyacrylamide gel electrophoresis (BN-PAGE) to visualize native protein complexes, complex I enzyme activity assays, cellular respiration measurements, and western blotting to assess the stability of complex I subunits .

How can splice-switching antisense oligonucleotides be designed to target TIMMDC1 intronic mutations?

Splice-switching antisense oligonucleotides (SSOs) have been designed to restore normal TIMMDC1 splicing in the context of the c.597-1340A>G deep intronic variant . Two different approaches have proven effective: (1) targeting the acceptor site of the major cryptic exon, and (2) targeting the A>G variant sequence located close to this splice site. Semi-quantitative RT-PCR analysis can be used to determine the relative levels of TIMMDC1 transcripts with or without the poison exon following SSO treatment . When designing SSOs, researchers should consider the specific location of the variant, the surrounding sequence context, and the mechanisms by which the variant enhances aberrant splicing. The successful application of SSOs to correct TIMMDC1 splicing defects demonstrates the potential of this approach for therapeutic intervention.

What methods can be used to analyze TIMMDC1 splicing abnormalities at the RNA level?

Several complementary techniques are effective for analyzing TIMMDC1 splicing abnormalities. RNA sequencing (RNAseq) can provide comprehensive insights into splicing patterns, as demonstrated by the analysis of TIMMDC1 transcripts in patients homozygous for the c.597-1340A>G variant . Sashimi plots from RNAseq data can visualize read density across exon-exon junctions, revealing aberrant splicing events. RT-PCR with poison exon-specific primers can determine the levels of aberrantly spliced TIMMDC1 transcripts in different samples, and Sanger sequencing of RT-PCR products can confirm the presence and sequence of poison exons . Additionally, RNA splicing prediction tools can be valuable for analyzing the potential impact of variants on splicing patterns when combined with genome sequencing data.

How does TIMMDC1 depletion affect mitochondrial function?

TIMMDC1 depletion results in reduced complex I activity and impaired cellular respiration due to defects in complex I assembly . Quantitative proteomics has demonstrated that TIMMDC1 is required for the assembly of both the membrane-embedded and soluble arms of complex I. The loss of TIMMDC1 leads to the accumulation of complex I subcomplexes characteristic of defects in the MCIA complex, with ensuing defects in complex I activity . Additionally, TIMMDC1 depletion decreases the stability of a subset of complex I subunits. These findings highlight the critical role of TIMMDC1 in maintaining proper mitochondrial function and energy production.

What are the effects of TIMMDC1 mutations in human patients?

Patients with biallelic TIMMDC1 mutations present with severe clinical phenotypes. Affected individuals exhibit failure to thrive in the early postnatal period, poor feeding, hypotonia, peripheral neuropathy, and drug-resistant epilepsy . At the molecular level, patient cells show almost complete loss of TIMMDC1 protein and compromised mitochondrial complex I function. The deep intronic c.597-1340A>G variant results in aberrant splicing that introduces a premature termination codon, leading to nonsense-mediated decay of the aberrant transcript . The severity of these clinical manifestations underscores the essential role of TIMMDC1 in normal development and neurological function.

What therapeutic approaches are being investigated for TIMMDC1-related diseases?

Research into therapeutic approaches for TIMMDC1-related diseases has focused on correcting aberrant splicing caused by intronic mutations. Splice-switching antisense oligonucleotides (SSOs) have been designed to restore normal TIMMDC1 splicing in the context of the c.597-1340A>G deep intronic variant . Two different SSO designs have proven effective: those targeting the acceptor site of the major cryptic exon and those targeting the A>G variant sequence located close to this splice site. This approach represents a promising therapeutic strategy for patients with TIMMDC1-related mitochondrial disease caused by splicing defects. As research progresses, additional therapeutic approaches targeting other aspects of mitochondrial function or specific downstream consequences of TIMMDC1 deficiency may emerge.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.